Recombinant Human Ephrin-A4 (EFNA4), partial (Active)

In Stock
Code CSB-AP005461HU
Abbreviation Recombinant Human EFNA4 protein, partial (Active)
MSDS
Size $96
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/μg as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human EphA7-His at 2μg/ml can bind Human EFNA4-Fc-His, the ED50 of Recombinant Human EFNA4-Fc-His is 1.5190 ug/ml.
Target Names
Uniprot No.
Research Area
Cardiovascular
Alternative Names
EFL 4; EFL4; EFN A4; EFNA 4; EFNA4; EFNA4_HUMAN; Eph related receptor tyrosine kinase ligand 4; EPH-related receptor tyrosine kinase ligand 4; Ephrin-A4; EphrinA4; EPLG 4; EPLG4; LERK 4; LERK-4; LERK4; Ligand of Eph related kinase 4; MGC125826
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
26-171aa
Complete Sequence
LRHVVYWNSSNPRLLRGDAVVELGLNDYLDIVCPHYEGPGPPEGPETFALYMVDWPGYESCQAEGPRAYKRWVCSLPFGHVQFSEKIQRFTPFSLGFEFLPGETYYYISVPTPESSGQCLRLQVSVCCKERKSESAHPVGSPGESG
Mol. Weight
44.3 kDa
Protein Length
Partial
Tag Info
C-terminal 6xHis-hFc-tagged
Form
Liquid or Lyophilized powder
Buffer
Lyophilized from a 0.2 μm filtered PBS, pH 7.4.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 1-3 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Human Ephrin-A4 (EFNA4) is produced using a mammalian cell expression system and covers amino acid region 26-171. The partial protein carries a C-terminal 6xHis-Fc tag, which makes purification and detection more straightforward. SDS-PAGE analysis confirms purity levels exceeding 95%. The protein shows biological activity - functional ELISA testing reveals a binding ED50 of 1.5190 ug/ml to Human EphA7-His. Endotoxin levels stay below 1.0 EU/μg.

Ephrin-A4 appears to play an important role in cell signaling, especially during development. As part of the ephrin family, it works with Eph receptors to enable cell-to-cell communication. This interaction seems critical for several pathways that affect how cells stick together, move around, and organize into tissues. These functions make Ephrin-A4 an interesting target for scientists studying how cells develop and communicate.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

1. Eph-Ephrin Signaling Pathway Studies

This recombinant EFNA4 protein may prove useful for investigating how Eph-ephrin signaling works at the molecular level in cell culture systems. The binding activity to EphA7 with a defined ED50 value makes it well-suited for dose-response experiments that examine receptor activation and the signaling events that follow. Scientists can study bidirectional signaling - both forward signaling through Eph receptors and reverse signaling through ephrin ligands. High purity and low endotoxin levels should give reliable results in sensitive cell-based experiments.

2. Receptor-Ligand Interaction Analysis

The C-terminal His-Fc tag allows for purification and detection in biochemical assays designed to characterize how Eph and ephrin proteins bind to each other. Surface plasmon resonance (SPR) or bio-layer interferometry (BLI) experiments can use this protein to measure binding kinetics, affinity constants, and how specifically it interacts with different Eph receptor family members. The Fc tag also makes it easy to attach the protein to protein A/G surfaces for binding studies. These interaction studies might provide useful quantitative data about receptor selectivity and how different proteins compete for binding sites within the Eph-ephrin system.

3. Cell Adhesion and Migration Assays

Scientists can attach EFNA4 to culture surfaces to study how it affects cell adhesion, spreading, and migration in laboratory conditions. The protein's biological activity and ability to engage Eph receptors suggests it could be valuable for investigating how cell-to-cell contact influences cellular behavior. Researchers might coat plates or beads with this protein to examine how EFNA4-Eph interactions change cell attachment, detachment, or directional movement. The mammalian expression system likely ensures proper protein folding and modifications that could be important for these cellular responses.

4. Antibody Development and Validation

The recombinant EFNA4 protein works well as an antigen for creating and testing antibodies that specifically recognize human ephrin-A4. High purity and the defined expression region (26-171aa) offer a consistent target for immunization protocols and antibody screening. The His-Fc tag makes purification and immobilization easier for ELISA-based antibody testing, while the demonstrated biological activity suggests the protein maintains proper shape. This protein can help validate antibody specificity, identify binding sites, and create standard curves for quantitative immunoassays.

5. Functional ELISA Development

Building on the activity testing approach described, this protein may be useful for developing and optimizing functional ELISA assays to study Eph-ephrin interactions. The established binding protocol with EphA7 and known ED50 value provide a starting point for creating standardized binding assays. Researchers could potentially use this protein to develop competitive binding assays, screen for small molecule inhibitors, or measure Eph receptor expression levels in cell lysates or tissue samples. The Fc tag helps with detection and the low endotoxin content should support assay reliability.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Cell surface GPI-bound ligand for Eph receptors, a family of receptor tyrosine kinases which are crucial for migration, repulsion and adhesion during neuronal, vascular and epithelial development. Binds promiscuously Eph receptors residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells. May play a role in the interaction between activated B-lymphocytes and dendritic cells in tonsils.
Gene References into Functions
  1. Study present for the first time in vitro and in vivo evidence suggesting that the major role of two ephrin A4 isoforms in chronic lymphocytic leukemia could be related with a non-previously described mechanism of survival linked to extravasation strongly dependent on integrin signaling. PMID: 27374180
  2. The cytoplasmic pattern of ephrin A4 could identify a subgroup of primary osteosarcoma patients with a high liability for progression, poor prognosis, and inferior response to chemotherapy. PMID: 20071790
  3. Characterization of the promoter PMID: 12030849
  4. This provides genetic evidence that Twist1, Msx2 and Efna4 function together in boundary formation and the pathogenesis of coronal synostosis. PMID: 16540516
  5. CLL B-cells showed a more heterogeneous Eph/EFN profile, specially EFNA4, EphB6 and EphA10. EphB6 and EFNA4 were further related with the clinical course of CLL. PMID: 18819711
  6. EFNA4-EphA2 interactions are involved in Chronic lymphocytic leukemia cell trafficking between blood and the tissues PMID: 19828693

Show More

Hide All

Subcellular Location
[Isoform 1]: Cell membrane; Lipid-anchor, GPI-anchor.; [Isoform 2]: Secreted.
Protein Families
Ephrin family
Tissue Specificity
Expressed in the adult spleen, lymph node, prostate, ovary, small intestine, and colon, and in fetal heart, lung, liver and kidney. Also detected in hematopoietic cell lines.
Database Links

HGNC: 3224

OMIM: 601380

KEGG: hsa:1945

STRING: 9606.ENSP00000414378

UniGene: Hs.449913

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*