Home
Active Protein
Other
Recombinant Human Syndecan-2 (SDC2), partial (Active)

Recombinant Human Syndecan-2 (SDC2), partial (Active)

^Unavailable

Code	CSB-AP005481HU
MSDS	MSDS Datasheet
Size	$136
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Customer Reviews and Q&A

Product Details

Purity

Greater than 95% as determined by SDS-PAGE.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Activity

The ED50 as determined by its ability to bind Human FGFb in functional ELISA is less than 5 ug/ml.

Target Names

SDC2

Uniprot No.

AAH49836.1

Research Area

Signal Transduction

Alternative Names

SDC2; HSPG1; Syndecan-2; SYND2; Fibroglycan; Heparan sulfate proteoglycan core protein; HSPG; CD antigen CD362

Species

Homo sapiens (Human)

Source

Mammalian cell

Expression Region

19-144aa

Complete Sequence

ESRAELTSDKDMYLDNSSIEEASGVYPIDDDDYASASGSGADEDVESPELTTTRPLPKILLTSAAPKVETTTLNIQNKIPAQTKSPEETDKEKVHLSDSERKMDPAEEDTNVYTEKHSDSLFKRTE

Mol. Weight

14.98 kDa

Protein Length

Partial

Tag Info

C-terminal 6xHis-tagged

Form

Liquid or Lyophilized powder

Buffer

Lyophilized from a 0.2 μm Filtered 20 mM Tris-Citrate, 150 mM NaCl, pH 7.0

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

Basically, we can dispatch the products out in 1-3 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.

Datasheet & COA

Please contact us to get it.

Description

Recombinant Human SDC2 is a premium-quality, C-terminal 6xHis-tagged partial protein that corresponds to the 19-144aa expression region of Syndecan-2 (SYND2; Fibroglycan; CD362). This protein, specifically designed for use in signal transduction research, is expressed in mammalian cells and boasts a purity of over 95% as determined by SDS-PAGE. Furthermore, its endotoxin levels are less than 1.0 EU/µg, as measured by the LAL method, ensuring minimal interference in experimental applications.

Recombinant Human SDC2 is fully biologically active, with its ED₅₀, as determined by its ability to bind Human FGFb in a functional ELISA, less than 5 µg/mL. This demonstrates the protein's efficacy in various research settings. Supplied in a lyophilized powder form, this product offers convenient storage and use across a wide range of experiments.