Recombinant Human Syndecan-2 (SDC2), partial (Active)

Discontinued
Code CSB-AP005481HU
MSDS
Size $136
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/μg as determined by LAL method.
Activity
The ED50 as determined by its ability to bind Human FGFb in functional ELISA is less than 5 ug/ml.
Target Names
SDC2
Uniprot No.
Research Area
Signal Transduction
Alternative Names
SDC2; HSPG1; Syndecan-2; SYND2; Fibroglycan; Heparan sulfate proteoglycan core protein; HSPG; CD antigen CD362
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
19-144aa
Complete Sequence
ESRAELTSDKDMYLDNSSIEEASGVYPIDDDDYASASGSGADEDVESPELTTTRPLPKILLTSAAPKVETTTLNIQNKIPAQTKSPEETDKEKVHLSDSERKMDPAEEDTNVYTEKHSDSLFKRTE
Mol. Weight
14.98 kDa
Protein Length
Partial
Tag Info
C-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Buffer
Lyophilized from a 0.2 μm Filtered 20 mM Tris-Citrate, 150 mM NaCl, pH 7.0
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 1-3 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Human SDC2 is a premium-quality, C-terminal 6xHis-tagged partial protein that corresponds to the 19-144aa expression region of Syndecan-2 (SYND2; Fibroglycan; CD362). This protein, specifically designed for use in signal transduction research, is expressed in mammalian cells and boasts a purity of over 95% as determined by SDS-PAGE. Furthermore, its endotoxin levels are less than 1.0 EU/µg, as measured by the LAL method, ensuring minimal interference in experimental applications.

Recombinant Human SDC2 is fully biologically active, with its ED50, as determined by its ability to bind Human FGFb in a functional ELISA, less than 5 µg/mL. This demonstrates the protein's efficacy in various research settings. Supplied in a lyophilized powder form, this product offers convenient storage and use across a wide range of experiments.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*