Code | CSB-MP023996HU1c9 |
Size | $368 |
Image |
|
Have Questions? | Leave a Message or Start an on-line Chat |
Description |
Human TNFSF8 amino acids (Gln63-Asp234) were expressed in the mammalian cells. The amino terminus contains the human IgG1 Fc-tag. The product is the partial length recombinant TNFSF8 protein. The SDS-PAGE assessed the purity of the protein to be greater than 94%. This TNFSF8 protein migrated to the molecular weight of about 55 kDa on the gel. The LAL method determined that the endotoxin content of the TNFSF8 protein was less than 1.0 EU/ug. This TNFSF8 protein has been validated to be biologically active through a functional ELISA. The receptor TNFRSF8 can bind to this TNFSF8 protein with the EC50 of about 4.169-6.360 ng/ml. It is in stock now. TNFSF8, also called CD153 or CD30L, is expressed on activated CD4+, CD8+ T cells, B cells, and macrophages. It mediates B cell growth and differentiation. Nancy D Marín and Luis F García found that TNFSF8-TNFRSF8 plays key roles in the T cell-dependent anti-mycobacterial immune response. |
Purity | Greater than 94% as determined by SDS-PAGE. |
Endotoxin | Less than 1.0 EU/ug as determined by LAL method. |
Activity | Measured by its binding ability in a functional ELISA. Immobilized CD30(CSB-MP023983HU1) at 5 μg/ml can bind human CD30L, the EC50 is 4.169-6.360 ng/ml. |
Target Names | TNFSF8 |
Uniprot No. | P32971 |
Alternative Names | TNFSF8; CD30L; CD30LG; Tumor necrosis factor ligand superfamily member 8; CD30 ligand; CD30-L; CD antigen CD153 |
Molecular Characterization | |
Species | Homo sapiens (Human) |
Source | Mammalian cell |
Expression Region | 63-234aa |
Target Protein Sequence | QRTDSIPNSPDNVPLKGGNCSEDLLCILKRAPFKKSWAYLQVAKHLNKTKLSWNKDGILHGVRYQDGNLVIQFPGLYFIICQLQFLVQCPNNSVDLKLELLINKHIKKQALVTVCESGMQTKHVYQNLSQFLLDYLQVNTTISVNVDTFQYIDTSTFPLENVLSIFLYSNSD |
Mol. Weight | 45.8 kDa |
Protein Length | Partial |
Tag Info |
N-terminal hFc-tagged |
Form |
Lyophilized powder Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand. |
Buffer | Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4 |
Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Troubleshooting and FAQs |
Protein FAQs |
Storage Condition | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Shelf Life | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
Lead Time | 3-7 business days |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Datasheet & COA | Please contact us to get it. |
There are currently no reviews for this product.
Function |
Cytokine that binds to TNFRSF8/CD30. Induces proliferation of T-cells.
|
Gene References into Functions |
|
Subcellular Location | Membrane; Single-pass type II membrane protein. |
Protein Families | Tumor necrosis factor family |
Database Links |
HGNC: 11938 OMIM: 603875 KEGG: hsa:944 STRING: 9606.ENSP00000223795 UniGene: Hs.494901 |