Home
Active Protein
Other
Recombinant Human Tumor necrosis factor ligand superfamily member 8 (TNFSF8), partial (Active)

Recombinant Human Tumor necrosis factor ligand superfamily member 8 (TNFSF8), partial (Active)

^{In Stock}

Code	CSB-MP023996HU1c9
Abbreviation	Recombinant Human TNFSF8 protein, partial (Active)
MSDS	MSDS Datasheet
Size	$136
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. Activity Measured by its binding ability in a functional ELISA. Immobilized CD30(CSB-MP023983HU1) at 5 μg/ml can bind human CD30L, the EC₅₀ is 4.169-6.360 ng/ml. Biological Activity Assay
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Endotoxin

Less than 1.0 EU/ug as determined by LAL method.

Activity

Measured by its binding ability in a functional ELISA. Immobilized CD30(CSB-MP023983HU1) at 5 μg/ml can bind human CD30L, the EC₅₀ is 4.169-6.360 ng/ml.

Target Names

TNFSF8

Uniprot No.

P32971

Alternative Names

TNFSF8; CD30L; CD30LG; Tumor necrosis factor ligand superfamily member 8; CD30 ligand; CD30-L; CD antigen CD153

Molecular Characterization

Species

Homo sapiens (Human)

Source

Mammalian cell

Expression Region

63-234aa

Target Protein Sequence

QRTDSIPNSPDNVPLKGGNCSEDLLCILKRAPFKKSWAYLQVAKHLNKTKLSWNKDGILHGVRYQDGNLVIQFPGLYFIICQLQFLVQCPNNSVDLKLELLINKHIKKQALVTVCESGMQTKHVYQNLSQFLLDYLQVNTTISVNVDTFQYIDTSTFPLENVLSIFLYSNSD

Mol. Weight

45.8 kDa

Protein Length

Partial

Tag Info

N-terminal hFc-tagged

Form

Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

CD30 ligand (TNFSF8) drives NF-κB signaling through CD30 engagement on activated T and B cells, making it a critical tool for dissecting lymphocyte activation and Hodgkin lymphoma biology. This recombinant human CD30L, spanning residues 63–234 with an N-terminal hFc tag, demonstrates potent receptor binding with an EC50 of 4.169–6.360 ng/ml against immobilized CD30 in functional ELISA, supporting its use as a coating antigen for antibody screening, a positive control in CD30/CD30L interaction assays, and a stimulus in cell-based activation or proliferation studies using primary lymphocytes. Endotoxin levels below 1.0 EU/μg minimize LPS-driven artifacts in sensitive immune cell experiments, while purity exceeding 90% by SDS-PAGE satisfies the quality thresholds commonly required for in vivo tumor models and NF-κB pathway signaling studies. The hFc fusion format also facilitates straightforward detection and crosslinking in functional assays requiring receptor clustering.

Customer Reviews and Q&A

■ Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function

Cytokine that binds to TNFRSF8/CD30. Induces proliferation of T-cells.

Gene References into Functions

circulant sCD30L is functionally active and that it may favor persistence of active inflammation by inducing apoptosis of CD30(+)T cells, known to down-modulate inflammation in rheumatoid synovitis. PMID: 24447865
TNFSF8 is an important leprosy T1R susceptibility gene. PMID: 25320285
The heritability of IgA levels is moderate and can partly be attributable to common variation in the CD30L locus. PMID: 24676358
The TNFSF8 polymorphisms rs927374 and rs2295800 were associated with neutrophil count. This finding suggests that post-MI inflammatory response is genetically modulated. PMID: 22033252
Positional candidate gene screening in the SPA2 locus allowed us to identify and replicate an association between a rare SNP located in TNFSF8 and spondylarthritis. PMID: 21480186
a possible role of novel TNFSF8 variants in susceptibility to lung cancer. PMID: 21292647
capability to up-regulate expression of CD30, release of soluble CD30 and production of IL-4 in pre-activated T cells upon co-culture PMID: 11728464
Mast cells were found to be the predominant CD30 ligand-positive (CD30L-positive) cell in the chronic inflammatory skin diseases psoriasis and atopic dermatitis. PMID: 16964309
CD153 antigen was expressed by synovial mast cells, and correlated with serum levels, in Rheumatoid Arthritis patients PMID: 19208589
Single nucleotide polymorphism in TNFSF8 gene is associated with bone disease in myeloma. PMID: 19657367