Purity
Greater than 90% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized CD30(CSB-MP023983HU1) at 5 μg/ml can bind human CD30L, the EC50 is 4.169-6.360 ng/ml.
Alternative Names
TNFSF8; CD30L; CD30LG; Tumor necrosis factor ligand superfamily member 8; CD30 ligand; CD30-L; CD antigen CD153
Molecular Characterization
Species
Homo sapiens (Human)
Expression Region
63-234aa
Target Protein Sequence
QRTDSIPNSPDNVPLKGGNCSEDLLCILKRAPFKKSWAYLQVAKHLNKTKLSWNKDGILHGVRYQDGNLVIQFPGLYFIICQLQFLVQCPNNSVDLKLELLINKHIKKQALVTVCESGMQTKHVYQNLSQFLLDYLQVNTTISVNVDTFQYIDTSTFPLENVLSIFLYSNSD
Tag Info
N-terminal hFc-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
Human TNFSF8 amino acids (Gln63-Asp234) were expressed in the mammalian cells. The amino terminus contains the human IgG1 Fc-tag. The product is the partial length recombinant TNFSF8 protein. The SDS-PAGE assessed the purity of the protein to be greater than 90%. This TNFSF8 protein migrated to the molecular weight of about 55 kDa on the gel. The LAL method determined that the endotoxin content of the TNFSF8 protein was less than 1.0 EU/ug. This TNFSF8 protein has been validated to be biologically active through a functional ELISA. The receptor TNFRSF8 can bind to this TNFSF8 protein with the EC50 of about 4.169-6.360 ng/ml. It is in stock now.
TNFSF8, also called CD153 or CD30L, is expressed on activated CD4+, CD8+ T cells, B cells, and macrophages. It mediates B cell growth and differentiation. Nancy D Marín and Luis F García found that TNFSF8-TNFRSF8 plays key roles in the T cell-dependent anti-mycobacterial immune response.