Code | CSB-MP023996HU1 |
Size | $368 |
Image |
|
Have Questions? | Leave a Message or Start an on-line Chat |
Description |
Human TNFSF8 amino acids Gly21-Glu147 with N-terminal 6xHis-tag were expressed in mammalian cells. The resulting product is the recombinant human TNFSF8 protein. This TNFSF8 protein was validated by SDS-PAGE analysis, and its purity is greater than 75%. It migrated to the molecular mass band of about 22 kDa on the gel. Its endotoxin level is less than 1.0 EU/ug determined by the LAL method. This TNFSF8 protein can bind to the immobilized CD30 in the functional ELISA, with an EC50 of 9.531-12.49 ng/ml. It shows the TNFSF8 is an active protein. And it is available now. TNFSF8, also called CD30L or CD153, is primarily expressed on activated T and B cells eosinophils, and macrophages. CD30L/CD30 signaling is involved in Th1, Th2, Th17 cell responses, and Th1-, and Th2- associated diseases. |
Purity | Greater than 75% as determined by SDS-PAGE. |
Endotoxin | Less than 1.0 EU/ug as determined by LAL method. |
Activity | Measured by its binding ability in a functional ELISA. Immobilized CD30(CSB-MP023983HU1h6) at 5 μg/ml can bind human CD30L, the EC50 is 9.531-12.49 ng/ml. |
Target Names | TNFSF8 |
Uniprot No. | P32971 |
Alternative Names | TNFSF8; CD30L; CD30LG; Tumor necrosis factor ligand superfamily member 8; CD30 ligand; CD30-L; CD antigen CD153 |
Molecular Characterization | |
Species | Homo sapiens (Human) |
Source | Mammalian cell |
Expression Region | 63-234aa |
Target Protein Sequence | QRTDSIPNSPDNVPLKGGNCSEDLLCILKRAPFKKSWAYLQVAKHLNKTKLSWNKDGILHGVRYQDGNLVIQFPGLYFIICQLQFLVQCPNNSVDLKLELLINKHIKKQALVTVCESGMQTKHVYQNLSQFLLDYLQVNTTISVNVDTFQYIDTSTFPLENVLSIFLYSNSD |
Mol. Weight | 21.8 kDa |
Protein Length | Partial |
Tag Info |
N-terminal 6xHis-tagged |
Form |
Lyophilized powder Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand. |
Buffer | Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0 |
Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Troubleshooting and FAQs |
Protein FAQs |
Storage Condition | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Shelf Life | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
Lead Time | 3-7 business days |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Datasheet & COA | Please contact us to get it. |
There are currently no reviews for this product.
Function |
Cytokine that binds to TNFRSF8/CD30. Induces proliferation of T-cells.
|
Gene References into Functions |
|
Subcellular Location | Membrane; Single-pass type II membrane protein. |
Protein Families | Tumor necrosis factor family |
Database Links |
HGNC: 11938 OMIM: 603875 KEGG: hsa:944 STRING: 9606.ENSP00000223795 UniGene: Hs.494901 |