Recombinant Human Tumor necrosis factor ligand superfamily member 8(TNFSF8),partial (Active)

In Stock
Code CSB-MP023996HU1
Size $368
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Activity
    Measured by its binding ability in a functional ELISA. Immobilized CD30(CSB-MP023983HU1h6) at 5 μg/ml can bind human CD30L, the EC50 is 9.531-12.49 ng/ml. Biological Activity Assay
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Description

Human TNFSF8 amino acids Gly21-Glu147 with N-terminal 6xHis-tag were expressed in mammalian cells. The resulting product is the recombinant human TNFSF8 protein. This TNFSF8 protein was validated by SDS-PAGE analysis, and its purity is greater than 75%. It migrated to the molecular mass band of about 22 kDa on the gel. Its endotoxin level is less than 1.0 EU/ug determined by the LAL method. This TNFSF8 protein can bind to the immobilized CD30 in the functional ELISA, with an EC50 of 9.531-12.49 ng/ml. It shows the TNFSF8 is an active protein. And it is available now.

TNFSF8, also called CD30L or CD153, is primarily expressed on activated T and B cells eosinophils, and macrophages. CD30L/CD30 signaling is involved in Th1, Th2, Th17 cell responses, and Th1-, and Th2- associated diseases.

Purity Greater than 75% as determined by SDS-PAGE.
Endotoxin Less than 1.0 EU/ug as determined by LAL method.
Activity Measured by its binding ability in a functional ELISA. Immobilized CD30(CSB-MP023983HU1h6) at 5 μg/ml can bind human CD30L, the EC50 is 9.531-12.49 ng/ml.
Target Names TNFSF8
Uniprot No. P32971
Alternative Names TNFSF8; CD30L; CD30LG; Tumor necrosis factor ligand superfamily member 8; CD30 ligand; CD30-L; CD antigen CD153
Molecular Characterization
Species Homo sapiens (Human)
Source Mammalian cell
Expression Region 63-234aa
Target Protein Sequence QRTDSIPNSPDNVPLKGGNCSEDLLCILKRAPFKKSWAYLQVAKHLNKTKLSWNKDGILHGVRYQDGNLVIQFPGLYFIICQLQFLVQCPNNSVDLKLELLINKHIKKQALVTVCESGMQTKHVYQNLSQFLLDYLQVNTTISVNVDTFQYIDTSTFPLENVLSIFLYSNSD
Mol. Weight 21.8
Protein Length Partial
Tag Info N-terminal 6xHis-tagged
Form Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time 3-7 business days
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Earn $30 Amazon Card or 20μL/μg CUSABIO Trial Size Antibody. Details of rewards >>

Target Background

Function
(From Uniprot)
Cytokine that binds to TNFRSF8/CD30. Induces proliferation of T-cells.
Gene References into Functions
  1. circulant sCD30L is functionally active and that it may favor persistence of active inflammation by inducing apoptosis of CD30(+)T cells, known to down-modulate inflammation in rheumatoid synovitis. PMID: 24447865
  2. TNFSF8 is an important leprosy T1R susceptibility gene. PMID: 25320285
  3. The heritability of IgA levels is moderate and can partly be attributable to common variation in the CD30L locus. PMID: 24676358
  4. The TNFSF8 polymorphisms rs927374 and rs2295800 were associated with neutrophil count. This finding suggests that post-MI inflammatory response is genetically modulated. PMID: 22033252
  5. Positional candidate gene screening in the SPA2 locus allowed us to identify and replicate an association between a rare SNP located in TNFSF8 and spondylarthritis. PMID: 21480186
  6. a possible role of novel TNFSF8 variants in susceptibility to lung cancer. PMID: 21292647
  7. capability to up-regulate expression of CD30, release of soluble CD30 and production of IL-4 in pre-activated T cells upon co-culture PMID: 11728464
  8. Mast cells were found to be the predominant CD30 ligand-positive (CD30L-positive) cell in the chronic inflammatory skin diseases psoriasis and atopic dermatitis. PMID: 16964309
  9. CD153 antigen was expressed by synovial mast cells, and correlated with serum levels, in Rheumatoid Arthritis patients PMID: 19208589
  10. Single nucleotide polymorphism in TNFSF8 gene is associated with bone disease in myeloma. PMID: 19657367

Show More

Hide All

Subcellular Location Membrane; Single-pass type II membrane protein.
Protein Families Tumor necrosis factor family
Database Links

HGNC: 11938

OMIM: 603875

KEGG: hsa:944

STRING: 9606.ENSP00000223795

UniGene: Hs.494901

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

© 2007-2021 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1