Recombinant Macaca fascicularis Folate receptor alpha(FOLR1),partial (Active)

In Stock
Code CSB-MP5002MOV
Abbreviation Recombinant Cynomolgus monkey FOLR1 protein, partial (Active)
MSDS
Size $138
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Activity
    Measured by its binding ability in a functional ELISA. Immobilized Cynomolgus FOLR1 at 2 μg/ml can bind Anti-FOLR1 recombinant antibody(CSB-RA008784MA1HU). The EC50 is 2.900-3.544 ng/mL. Biological Activity Assay
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Cynomolgus FOLR1 at 2 μg/mL can bind Anti-FOLR1 recombinant antibody(CSB-RA008784MA1HU). The EC50 is 2.900-3.544 ng/mL.
Target Names
Uniprot No.
Species
Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
Source
Mammalian cell
Expression Region
25-233aa
Target Protein Sequence
RTARARTELLNVCMNAKHHKEKPGPEDKLHEQCRPWKKNACCSTNTSQEAHKDVSYLYRFNWNHCGEMAPACKRHFIQDTCLYECSPNLGPWIQQVDQSWRKERVLNVPLCKEDCEQWWEDCRTSYTCKSNWHKGWNWTSGFNKCPVGAACQPFHFYFPTPTVLCNEIWTYSYKVSNYSRGSGRCIQMWFDPAQGNPNEEVARFYAAAM
Mol. Weight
26.0 kDa
Protein Length
Partial
Tag Info
C-terminal 10xHis-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The recombinant Macaca fascicularis FOLR1 protein is an active, high-purity product expressed in mammalian cells to ensure native-like folding and functionality. It includes amino acids 25 to 233 of the original sequence and features a C-terminal 10xHis tag for streamlined purification and assay use. The recombinant FOLR1 protein achieves a purity level above 95%, confirmed by SDS-PAGE. Endotoxin levels are maintained below 1.0 EU/µg, as determined by the LAL method, ensuring compatibility with sensitive biological assays. Functional activity is validated through ELISA, where immobilized FOLR1 at 2 μg/mL binds specifically to the anti-FOLR1 recombinant antibody (CSB-RA008784MA1HU), with an EC50 between 2.900 and 3.544 ng/mL. These properties make it a reliable tool for applications in receptor-ligand studies, antibody screening, and folate pathway research.

The FOLR1 protein, or folate receptor alpha, is a crucial component in cellular functions, particularly in folate transport, which is vital for cellular growth and metabolism. In Macaca fascicularis, this protein has been investigated with various biological processes, particularly its role in reproductive biology, immunity, and disease models.

FOLR1 is integral to folate transport, which is essential for nucleotide synthesis and thereby supports rapid cellular proliferation. This function is particularly significant in the reproductive systems of non-human primates, including M. fascicularis. The protein's expression in the testis is noteworthy, as it supports the spermatogenic process and ensures successful gamete formation. Studies suggest the uniqueness of gene expression programs in the testes of primates, indicating possible adaptations that FOLR1 might have undergone in response to evolutionary pressures [1].

Furthermore, M. fascicularis serves as an important model organism in immunological studies. The expression and function of receptors such as FOLR1 may influence immune responses, including those related to vaccination and disease resistance [2]. For instance, FOLR1 is involved in the cellular uptake of folate, which can modulate immune cell function and proliferation, directly influencing vaccine efficacy and the development of autoimmune diseases [3]. The role of folate is significant due to its involvement in critical immune system interactions and its implications in health and disease.

In addition, M. fascicularis is frequently utilized in biomedical research about human diseases. Their genomic and physiological similarities to humans make them a suitable model for studying various conditions, including cancers, where FOLR1 expression is often altered. Insights into FOLR1's role could enhance therapeutic strategies targeting cancers where this protein is implicated in cell survival and proliferation pathways [4].

References:
[1] A. Boukaba, J. Liu, et al. Ectopic expression of meiotic cohesin generates chromosome instability in cancer cell line. Proceedings of the National Academy of Sciences, vol. 119, no. 40, 2022. https://doi.org/10.1073/pnas.2204071119
[2] A. Higashino, R. Sakate,.et al. Whole-genome sequencing and analysis of the malaysian cynomolgus macaque (macaca fascicularis) genome. Genome Biology, vol. 13, no. 7, 2012. https://doi.org/10.1186/gb-2012-13-7-r58
[3] R. Campos, E. McDonald, A. Brault, & S. Rossi. Animal models of zika virus sexual transmission. 2021. https://doi.org/10.5772/intechopen.91256
[4] S. Laila, D. Astuti, I. Suparto, E. Handharyani, T. Register, & D. Sajuthi. Atherosclerotic lesion of the carotid artery in indonesian cynomolgus monkeys receiving a locally sourced atherogenic diet. Veterinary Sciences, vol. 9, no. 3, p. 105, 2022. https://doi.org/10.3390/vetsci9030105

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*