Purity

≥ 95% as determined by SDS-PAGE.

Endotoxin

Less than 1.0 EU/ug as determined by LAL method.

Activity

Measured by its binding ability in a functional ELISA. Immobilized Cynomolgus FOLR1 at 2 μg/mL can bind Anti-FOLR1 recombinant antibody(CSB-RA008784MA1HU). The EC50 is 2.900-3.544 ng/mL.

Target Names

FOLR1

Uniprot No.

A0A2K5U044

Species

Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Source

Mammalian cell

Expression Region

25-233aa

Target Protein Sequence

RTARARTELLNVCMNAKHHKEKPGPEDKLHEQCRPWKKNACCSTNTSQEAHKDVSYLYRFNWNHCGEMAPACKRHFIQDTCLYECSPNLGPWIQQVDQSWRKERVLNVPLCKEDCEQWWEDCRTSYTCKSNWHKGWNWTSGFNKCPVGAACQPFHFYFPTPTVLCNEIWTYSYKVSNYSRGSGRCIQMWFDPAQGNPNEEVARFYAAAM

Mol. Weight

26.0 kDa

Protein Length

Partial

Tag Info

C-terminal 10xHis-tagged

Form

Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

Folate receptor alpha serves as a validated target in antibody-drug conjugate development and tumor-targeted therapy, making conformationally authentic recombinant protein essential for screening and characterization workflows. This cynomolgus FOLR1 fragment, spanning residues 25–233 and expressed in mammalian cells to preserve native glycosylation and disulfide architecture, demonstrates quantifiable antibody-binding activity with an EC50 of 2.900–3.544 ng/mL in functional ELISA, providing a reliable basis for therapeutic antibody epitope mapping, competitive inhibition screening, and blocking antibody validation. The low endotoxin level (< 1.0 EU/μg) and greater than 95% purity support its use in surface plasmon resonance and biolayer interferometry experiments where contaminants would compromise affinity measurements. Researchers conducting ligand-receptor interaction studies or small-molecule inhibitor screening can leverage this validated reagent as a positive control or immobilized ligand in binding assays that demand reproducible, quantitative readouts.

Code	CSB-MP5002MOV
Abbreviation	Recombinant Cynomolgus monkey FOLR1 protein, partial (Active)
MSDS	MSDS Datasheet
Size	$138
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. Activity Measured by its binding ability in a functional ELISA. Immobilized Cynomolgus FOLR1 at 2 μg/ml can bind Anti-FOLR1 recombinant antibody(CSB-RA008784MA1HU). The EC₅₀ is 2.900-3.544 ng/mL. Biological Activity Assay
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Macaca fascicularis Folate receptor alpha(FOLR1),partial (Active)

Product Details

Customer Reviews and Q&A

×CloseMessage