Name: Recombinant Mouse Carbonic anhydrase 14(Ca14),partial (Active)
Brand: CUSABIO
SKU: CSB-AP005781MO

Product Details

Purity	Greater than 95% as determined by SDS-PAGE.
Endotoxin	Less than 1.0 EU/μg as determined by LAL method.
Activity	The esterase activity is determined to be greater than 400 pmol/min/?g.
Target Names	Ca14
Uniprot No.	Q9WVT6
Research Area	Neuroscience
Alternative Names	Ca14; Car14; CatmCarbonic anhydrase 14; EC 4.2.1.1; Carbonate dehydratase XIV; Carbonic anhydrase XIV; CA-XIV
Species	Mus musculus (Mouse)
Source	Mammalian cell
Expression Region	16-290aa
Complete Sequence	ADGGHHWTYEGPHGQDHWPTSYPECGGDAQSPINIQTDSVIFDPDLPAVQPHGYDQLGTEPLDLHNNGHTVQLSLPPTLHLGGLPRKYTAAQLHLHWGQRGSLEGSEHQINSEATAAELHVVHYDSQSYSSLSEAAQKPQGLAVLGILIEVGETENPAYDHILSRLHEIRYKDQKTSVPPFSVRELFPQQLEQFFRYNGSLTTPPCYQSVLWTVFNRRAQISMGQLEKLQETLSSTEEDPSEPLVQNYRVPQPLNQRTIFASFIQAGPLYTTGEM
Mol. Weight	31.8 kDa
Protein Length	Partial
Tag Info	C-terminal 6xHis-tagged
Form	Liquid
Buffer	0.2 μm filtered 20 mM Tris-HCl, 150 mM NaCl, pH 8.0
Troubleshooting and FAQs	Protein FAQs
Storage Condition	Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time	Basically, we can dispatch the products out in 5-10 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA	Please contact us to get it.

Target Background

Function	Reversible hydration of carbon dioxide.
Gene References into Functions	During inner ear development, transcripts of four cytosolic isozymes (Car1, Car2, Car3, and Car13), two membrane-bound isozymes (Car12 and Car14), and two CA-related proteins (Car8 and Car11) were expressed at higher levels than other isozymes. PMID: 23233153 CAXIV functionally interacts with AE3, forming an extracellular membrane protein complex involved in the regulation of bicarbonate metabolism and pHi in the heart. PMID: 22227327 The presence of CA XIV in the hepatocyte plasma membrane places it at a strategic site to control pH regulation and ion transport between the hepatocytes, sinusoids and bile canaliculi. PMID: 12033992 carbonic anhydrase XIV has a role in selective inhibition of membrane-associated isozymes PMID: 14660577 studies on hippocampal slices on these KO mice showed that either CA can mediate buffering after synaptic transmission in hippocampal slices in the absence of the other, but that eliminating both is as effective in blocking the buffering seen in WT mice PMID: 16260723 CA XIV is expressed in sarcoplasmic reticulum and sarcolemma of skeletal muscle. PMID: 17459948 CA XIV, which regulates extracellular pH and pCO(2), plays an important part in producing a normal retinal light response. PMID: 17485676 CA XIV (along with carbonic anhydrase 4) plays an important role in the regulation of intracellular pH in hippocampus, via facilitation of anion exchanger AE3-mediated chloride-bicarbonate antiporter HCO3 exchange. PMID: 19279262 Show More Hide All
Subcellular Location	Membrane; Single-pass type I membrane protein.
Protein Families	Alpha-carbonic anhydrase family
Tissue Specificity	Most abundant in the kidney and heart, followed by the skeletal muscle, brain, lung and liver.
Database Links	KEGG: mmu:23831 UniGene: Mm.489647

CloseMessage

Product >> Product Name：
Product >> Code：
Product >> Size：
Name： *
Email： *
Phone：
We recommend you to leave your phone number because occasionally our emails get flagged by spam filters. We would not disclose any of your private information to any third party.
Question/Comment： *
Your Region： *
Country State：
I'd like to receive email newsletters from Cusabio

Yes

No
How do you know CUSABIO?

Email

Distributor

Search engine

Advertisement

Others
Check Code：

Code	CSB-AP005781MO
Size	InquiryPurchase it in Cusabio online store (only available for customers from the US)
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Mouse Carbonic anhydrase 14(Ca14),partial (Active)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

CloseMessage

×CloseMessage