Code | CSB-AP005781MO |
Size |
InquiryPurchase it in Cusabio online store (only available for customers from the US) |
Image | |
Have Questions? | Leave a Message or Start an on-line Chat |
Purity | Greater than 95% as determined by SDS-PAGE. |
Endotoxin | Less than 1.0 EU/μg as determined by LAL method. |
Activity | The esterase activity is determined to be greater than 400 pmol/min/?g. |
Target Names | Ca14 |
Uniprot No. | Q9WVT6 |
Research Area | Neuroscience |
Alternative Names | Ca14; Car14; CatmCarbonic anhydrase 14; EC 4.2.1.1; Carbonate dehydratase XIV; Carbonic anhydrase XIV; CA-XIV |
Species | Mus musculus (Mouse) |
Source | Mammalian cell |
Expression Region | 16-290aa |
Complete Sequence | ADGGHHWTYEGPHGQDHWPTSYPECGGDAQSPINIQTDSVIFDPDLPAVQPHGYDQLGTEPLDLHNNGHTVQLSLPPTLHLGGLPRKYTAAQLHLHWGQRGSLEGSEHQINSEATAAELHVVHYDSQSYSSLSEAAQKPQGLAVLGILIEVGETENPAYDHILSRLHEIRYKDQKTSVPPFSVRELFPQQLEQFFRYNGSLTTPPCYQSVLWTVFNRRAQISMGQLEKLQETLSSTEEDPSEPLVQNYRVPQPLNQRTIFASFIQAGPLYTTGEM |
Mol. Weight | 31.8 kDa |
Protein Length | Partial |
Tag Info |
C-terminal 6xHis-tagged |
Form | Liquid |
Buffer | 0.2 μm filtered 20 mM Tris-HCl, 150 mM NaCl, pH 8.0 |
Troubleshooting and FAQs |
Protein FAQs |
Storage Condition | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Shelf Life | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
Lead Time | Basically, we can dispatch the products out in 5-10 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Datasheet & COA | Please contact us to get it. |
There are currently no reviews for this product.
Function |
Reversible hydration of carbon dioxide.
|
Gene References into Functions |
|
Subcellular Location | Membrane; Single-pass type I membrane protein. |
Protein Families | Alpha-carbonic anhydrase family |
Tissue Specificity | Most abundant in the kidney and heart, followed by the skeletal muscle, brain, lung and liver. |
Database Links |
KEGG: mmu:23831 UniGene: Mm.489647 |