Recombinant Mouse Carbonic anhydrase 14(Ca14),partial (Active)

^{In Stock}

Code	CSB-AP005781MO
Size	US$3564Purchase it in Cusabio online store (only available for customers from the US)
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Product Details
Related Products
Target Data

Product Details

Purity	Greater than 95% as determined by SDS-PAGE.
Endotoxin	Less than 1.0 EU/μg as determined by LAL method.
Activity	The esterase activity is determined to be greater than 400 pmol/min/?g.
Target Names	Ca14
Uniprot No.	Q9WVT6
Research Area	Neuroscience
Alternative Names	Carbonic Anhydrase 14; Carbonate Dehydratase XIV; Carbonic Anhydrase XIV; CA-XIV; CA14;
Species	Mus musculus (Mouse)
Source	Mammalian cell
Expression Region	16-290aa
Complete Sequence	ADGGHHWTYEGPHGQDHWPTSYPECGGDAQSPINIQTDSVIFDPDLPAVQPHGYDQLGTEPLDLHNNGHTVQLSLPPTLHLGGLPRKYTAAQLHLHWGQRGSLEGSEHQINSEATAAELHVVHYDSQSYSSLSEAAQKPQGLAVLGILIEVGETENPAYDHILSRLHEIRYKDQKTSVPPFSVRELFPQQLEQFFRYNGSLTTPPCYQSVLWTVFNRRAQISMGQLEKLQETLSSTEEDPSEPLVQNYRVPQPLNQRTIFASFIQAGPLYTTGEM
Mol. Weight	31.8 kDa
Protein Length	Partial
Tag Info	C-terminal 6xHis-tagged
Form	Liquid
Buffer	0.2 μm filtered 20 mM Tris-HCl, 150 mM NaCl, pH 8.0
Troubleshooting and FAQs	Protein FAQs
Storage Condition	Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time	Basically, we can dispatch the products out in 5-10 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Datasheet & COA	Please contact us to get it.
Still Have Questions?	Leave a Message or Start an on-line Chat

Target Data

Function	Reversible hydration of carbon dioxide.
Subcellular Location	Membrane, Single-pass type I membrane protein
Protein Families	Alpha-carbonic anhydrase family
Tissue Specificity	Most abundant in the kidney and heart, followed by the skeletal muscle, brain, lung and liver.
Database Links	KEGG: mmu:23831 UniGene: Mm.489647