Recombinant Mouse Carbonic anhydrase 14 (Ca14), partial (Active)

Discontinued
Code CSB-AP005781MO
MSDS
Size $290
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/μg as determined by LAL method.
Activity
The esterase activity is determined to be greater than 400 pmol/min/?g.
Target Names
Ca14
Uniprot No.
Research Area
Neuroscience
Alternative Names
Ca14; Car14; CatmCarbonic anhydrase 14; EC 4.2.1.1; Carbonate dehydratase XIV; Carbonic anhydrase XIV; CA-XIV
Species
Mus musculus (Mouse)
Source
Mammalian cell
Expression Region
16-290aa
Complete Sequence
ADGGHHWTYEGPHGQDHWPTSYPECGGDAQSPINIQTDSVIFDPDLPAVQPHGYDQLGTEPLDLHNNGHTVQLSLPPTLHLGGLPRKYTAAQLHLHWGQRGSLEGSEHQINSEATAAELHVVHYDSQSYSSLSEAAQKPQGLAVLGILIEVGETENPAYDHILSRLHEIRYKDQKTSVPPFSVRELFPQQLEQFFRYNGSLTTPPCYQSVLWTVFNRRAQISMGQLEKLQETLSSTEEDPSEPLVQNYRVPQPLNQRTIFASFIQAGPLYTTGEM
Mol. Weight
31.8 kDa
Protein Length
Partial
Tag Info
C-terminal 6xHis-tagged
Form
Liquid
Buffer
0.2 μm filtered 20 mM Tris-HCl, 150 mM NaCl, pH 8.0
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 5-10 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Reversible hydration of carbon dioxide.
Gene References into Functions
  1. During inner ear development, transcripts of four cytosolic isozymes (Car1, Car2, Car3, and Car13), two membrane-bound isozymes (Car12 and Car14), and two CA-related proteins (Car8 and Car11) were expressed at higher levels than other isozymes. PMID: 23233153
  2. CAXIV functionally interacts with AE3, forming an extracellular membrane protein complex involved in the regulation of bicarbonate metabolism and pHi in the heart. PMID: 22227327
  3. The presence of CA XIV in the hepatocyte plasma membrane places it at a strategic site to control pH regulation and ion transport between the hepatocytes, sinusoids and bile canaliculi. PMID: 12033992
  4. carbonic anhydrase XIV has a role in selective inhibition of membrane-associated isozymes PMID: 14660577
  5. studies on hippocampal slices on these KO mice showed that either CA can mediate buffering after synaptic transmission in hippocampal slices in the absence of the other, but that eliminating both is as effective in blocking the buffering seen in WT mice PMID: 16260723
  6. CA XIV is expressed in sarcoplasmic reticulum and sarcolemma of skeletal muscle. PMID: 17459948
  7. CA XIV, which regulates extracellular pH and pCO(2), plays an important part in producing a normal retinal light response. PMID: 17485676
  8. CA XIV (along with carbonic anhydrase 4) plays an important role in the regulation of intracellular pH in hippocampus, via facilitation of anion exchanger AE3-mediated chloride-bicarbonate antiporter HCO3 exchange. PMID: 19279262

Show More

Hide All

Subcellular Location
Membrane; Single-pass type I membrane protein.
Protein Families
Alpha-carbonic anhydrase family
Tissue Specificity
Most abundant in the kidney and heart, followed by the skeletal muscle, brain, lung and liver.
Database Links

KEGG: mmu:23831

UniGene: Mm.489647

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*