Recombinant Mouse Carbonic anhydrase 14(Ca14),partial (Active)

In Stock
Code CSB-AP005781MO
Size US$3564Purchase it in Cusabio online store
(only available for customers from the US)
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity Greater than 95% as determined by SDS-PAGE.
Endotoxin Less than 1.0 EU/μg as determined by LAL method.
Activity The esterase activity is determined to be greater than 400 pmol/min/?g.
Target Names Ca14
Uniprot No. Q9WVT6
Research Area Neuroscience
Alternative Names Ca14; Car14; CatmCarbonic anhydrase 14; EC 4.2.1.1; Carbonate dehydratase XIV; Carbonic anhydrase XIV; CA-XIV
Species Mus musculus (Mouse)
Source Mammalian cell
Expression Region 16-290aa
Complete Sequence ADGGHHWTYEGPHGQDHWPTSYPECGGDAQSPINIQTDSVIFDPDLPAVQPHGYDQLGTEPLDLHNNGHTVQLSLPPTLHLGGLPRKYTAAQLHLHWGQRGSLEGSEHQINSEATAAELHVVHYDSQSYSSLSEAAQKPQGLAVLGILIEVGETENPAYDHILSRLHEIRYKDQKTSVPPFSVRELFPQQLEQFFRYNGSLTTPPCYQSVLWTVFNRRAQISMGQLEKLQETLSSTEEDPSEPLVQNYRVPQPLNQRTIFASFIQAGPLYTTGEM
Mol. Weight 31.8 kDa
Protein Length Partial
Tag Info C-terminal 6xHis-tagged
Form Liquid
Buffer 0.2 μm filtered 20 mM Tris-HCl, 150 mM NaCl, pH 8.0
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Basically, we can dispatch the products out in 5-10 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Earn $30 Amazon Card or 20μL/μg CUSABIO Trial Size Antibody. Details of rewards >>

Target Background

Function
(From Uniprot)
Reversible hydration of carbon dioxide.
Gene References into Functions
  1. During inner ear development, transcripts of four cytosolic isozymes (Car1, Car2, Car3, and Car13), two membrane-bound isozymes (Car12 and Car14), and two CA-related proteins (Car8 and Car11) were expressed at higher levels than other isozymes. PMID: 23233153
  2. CAXIV functionally interacts with AE3, forming an extracellular membrane protein complex involved in the regulation of bicarbonate metabolism and pHi in the heart. PMID: 22227327
  3. The presence of CA XIV in the hepatocyte plasma membrane places it at a strategic site to control pH regulation and ion transport between the hepatocytes, sinusoids and bile canaliculi. PMID: 12033992
  4. carbonic anhydrase XIV has a role in selective inhibition of membrane-associated isozymes PMID: 14660577
  5. studies on hippocampal slices on these KO mice showed that either CA can mediate buffering after synaptic transmission in hippocampal slices in the absence of the other, but that eliminating both is as effective in blocking the buffering seen in WT mice PMID: 16260723
  6. CA XIV is expressed in sarcoplasmic reticulum and sarcolemma of skeletal muscle. PMID: 17459948
  7. CA XIV, which regulates extracellular pH and pCO(2), plays an important part in producing a normal retinal light response. PMID: 17485676
  8. CA XIV (along with carbonic anhydrase 4) plays an important role in the regulation of intracellular pH in hippocampus, via facilitation of anion exchanger AE3-mediated chloride-bicarbonate antiporter HCO3 exchange. PMID: 19279262

Show More

Hide All

Subcellular Location Membrane, Single-pass type I membrane protein
Protein Families Alpha-carbonic anhydrase family
Tissue Specificity Most abundant in the kidney and heart, followed by the skeletal muscle, brain, lung and liver.
Database Links

KEGG: mmu:23831

UniGene: Mm.489647

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

© 2007-2021 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1