Product Details

Purity

Greater than 95% as determined by SDS-PAGE.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Activity

The esterase activity is determined to be greater than 400 pmol/min/?g.

Target Names

Ca14

Uniprot No.

Q9WVT6

Research Area

Neuroscience

Alternative Names

Ca14; Car14; CatmCarbonic anhydrase 14; EC 4.2.1.1; Carbonate dehydratase XIV; Carbonic anhydrase XIV; CA-XIV

Species

Mus musculus (Mouse)

Source

Mammalian cell

Expression Region

16-290aa

Complete Sequence

ADGGHHWTYEGPHGQDHWPTSYPECGGDAQSPINIQTDSVIFDPDLPAVQPHGYDQLGTEPLDLHNNGHTVQLSLPPTLHLGGLPRKYTAAQLHLHWGQRGSLEGSEHQINSEATAAELHVVHYDSQSYSSLSEAAQKPQGLAVLGILIEVGETENPAYDHILSRLHEIRYKDQKTSVPPFSVRELFPQQLEQFFRYNGSLTTPPCYQSVLWTVFNRRAQISMGQLEKLQETLSSTEEDPSEPLVQNYRVPQPLNQRTIFASFIQAGPLYTTGEM

Mol. Weight

31.8 kDa

Protein Length

Partial

Tag Info

C-terminal 6xHis-tagged

Form

Liquid

Buffer

0.2 μm filtered 20 mM Tris-HCl, 150 mM NaCl, pH 8.0

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

Basically, we can dispatch the products out in 5-10 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Target Background

Function

Reversible hydration of carbon dioxide.

Gene References into Functions

During inner ear development, transcripts of four cytosolic isozymes (Car1, Car2, Car3, and Car13), two membrane-bound isozymes (Car12 and Car14), and two CA-related proteins (Car8 and Car11) were expressed at higher levels than other isozymes. PMID: 23233153
CAXIV functionally interacts with AE3, forming an extracellular membrane protein complex involved in the regulation of bicarbonate metabolism and pHi in the heart. PMID: 22227327
The presence of CA XIV in the hepatocyte plasma membrane places it at a strategic site to control pH regulation and ion transport between the hepatocytes, sinusoids and bile canaliculi. PMID: 12033992
carbonic anhydrase XIV has a role in selective inhibition of membrane-associated isozymes PMID: 14660577
studies on hippocampal slices on these KO mice showed that either CA can mediate buffering after synaptic transmission in hippocampal slices in the absence of the other, but that eliminating both is as effective in blocking the buffering seen in WT mice PMID: 16260723
CA XIV is expressed in sarcoplasmic reticulum and sarcolemma of skeletal muscle. PMID: 17459948
CA XIV, which regulates extracellular pH and pCO(2), plays an important part in producing a normal retinal light response. PMID: 17485676
CA XIV (along with carbonic anhydrase 4) plays an important role in the regulation of intracellular pH in hippocampus, via facilitation of anion exchanger AE3-mediated chloride-bicarbonate antiporter HCO3 exchange. PMID: 19279262

Hide All

Subcellular Location

Membrane; Single-pass type I membrane protein.

Protein Families

Alpha-carbonic anhydrase family

Tissue Specificity

Most abundant in the kidney and heart, followed by the skeletal muscle, brain, lung and liver.

Database Links

KEGG: mmu:23831

UniGene: Mm.489647

Message

Product >> Product Name：
Product >> Code：
Name： *
Email： *
Company/Organization：
Phone：
Since emails may get flagged by spam filters occasionally, we recommend leaving your phone number as a precaution. Your information is safe with us.
Question/Comment： *
Your Region： *
I'd like to receive email newsletters from Cusabio

Yes

No
How do you know CUSABIO?

Email

Distributor

Search engine

Advertisement

Others
CAPTCHA verification：
If CAPTCHA verification fails, click to refresh the CAPTCHA and try again.

Code	CSB-AP005781MO
MSDS	MSDS Datasheet
Size	$290
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Mouse Carbonic anhydrase 14 (Ca14), partial (Active)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage