Recombinant Salmonella typhi DNA-binding protein HU-beta (hupB)

In Stock
Code CSB-EP363134SWW
Abbreviation Recombinant Salmonella typhi hupB protein
MSDS
Size US$388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
hupB
Uniprot No.
Research Area
others
Alternative Names
hupB; STY0493; t2409DNA-binding protein HU-beta; HU-1; NS1
Species
Salmonella typhi
Source
E.coli
Expression Region
1-90aa
Target Protein Sequence
MNKSQLIEKIAAGADISKAAAGRALDAIIASVTESLKEGDDVALVGFGTFAVKERAARTGRNPQTGKEITIAAAKVPSFRAGKALKDAVN
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
29.2kDa
Protein Length
Full Length
Tag Info
N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

This recombinant DNA-binding protein HU-beta from Salmonella typhi is expressed in E.coli and includes the full-length sequence from 1-90 amino acids. The protein carries an N-terminal 10xHis-SUMO tag and a C-terminal Myc tag, which streamlines purification and detection steps. Purity appears to exceed 90% as verified by SDS-PAGE, providing what seems to be a reliable reagent for research applications. This product is intended for research use only.

HU-beta is a DNA-binding protein that may play a crucial role in organizing and compacting bacterial chromosomal DNA. It's known for its ability to bend DNA, which likely influences processes such as replication, transcription, and recombination. As one of the nucleoid-associated proteins, HU-beta could be significant in studies examining DNA architecture and gene regulation in prokaryotic systems.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Salmonella typhi DNA-binding protein HU-beta is a bacterial nucleoid-associated protein that requires precise folding, proper dimerization, and specific tertiary structure for its functional activity in DNA binding and nucleoid organization. The E. coli expression system is homologous to this bacterial protein, which increases the probability of correct folding. However, the large N-terminal 10xHis-SUMO tag (∼15 kDa) and C-terminal Myc-tag are significantly larger than the protein itself (90 aa, ∼10 kDa), creating severe steric interference that may disrupt dimerization and DNA-binding domains. While the full-length protein (1-90aa) contains all functional domains, the probability of correct folding with functional DNA-binding activity is low without experimental validation of dimerization and DNA-binding capability.

1. DNA-Protein Interaction Studies Using Electrophoretic Mobility Shift Assays (EMSA)

This application carries a significant risk without functional validation. HU-beta's DNA-binding activity requires precise dimerization and proper tertiary structure. If correctly folded and active (verified through DNA-binding assays), the protein may be suitable for EMSA studies. If misfolded/inactive (unverified), binding data will yield biologically meaningless results due to potential steric interference from the large tags.

2. Antibody Development and Immunoassay Optimization

This application is highly suitable as antibody development relies on antigenic sequence recognition rather than functional protein folding. The full-length protein provides comprehensive epitope coverage for generating HU-beta-specific antibodies. The high purity (>90%) ensures minimal contamination-related issues during immunization protocols.

3. Protein-Protein Interaction Mapping via Pull-Down Assays

This application requires proper folding and dimerization validation. HU-beta interactions with other nucleoid proteins require native conformation. If correctly folded (verified), the protein may identify physiological interaction partners. If misfolded/unverified, there is a high risk of non-specific binding or tag-mediated artefacts.

4. Comparative Structural and Functional Analysis
Meaningful comparative studies require native protein conformation and functional activity. If correctly folded and active (verified), the protein enables valid evolutionary comparisons. If misfolded/inactive (unverified), comparative analyses would yield misleading insights about HU protein conservation and function.

Final Recommendation & Action Plan

The E. coli-expressed HU-beta with large dual tags poses challenges for functional studies due to the severe steric interference from tags relative to the small protein size. Begin with biophysical characterization (e.g., size-exclusion chromatography for dimerization analysis, circular dichroism spectroscopy for secondary structure) and validate DNA-binding activity using EMSA before considering functional applications. Applications 2 (antibody development) can proceed immediately. Applications 1, 3, and 4 require rigorous functional validation. For reliable HU-beta research, consider tag removal or use tag-free constructs to minimize interference with dimerization and DNA-binding domains.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Histone-like DNA-binding protein which is capable of wrapping DNA to stabilize it, and thus to prevent its denaturation under extreme environmental conditions.
Protein Families
Bacterial histone-like protein family
Database Links

KEGG: stt:t2409

STRING: 220341.STY0493

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*