Recombinant Salmonella typhi DNA-binding protein HU-beta (hupB)

In Stock
Code CSB-EP363134SWW
Abbreviation Recombinant Salmonella typhi hupB protein
MSDS
Size US$388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
hupB
Uniprot No.
Research Area
others
Alternative Names
hupB; STY0493; t2409DNA-binding protein HU-beta; HU-1; NS1
Species
Salmonella typhi
Source
E.coli
Expression Region
1-90aa
Target Protein Sequence
MNKSQLIEKIAAGADISKAAAGRALDAIIASVTESLKEGDDVALVGFGTFAVKERAARTGRNPQTGKEITIAAAKVPSFRAGKALKDAVN
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
29.2kDa
Protein Length
Full Length
Tag Info
N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

This recombinant DNA-binding protein HU-beta from Salmonella typhi is expressed in E.coli and includes the full-length sequence from 1-90 amino acids. The protein carries an N-terminal 10xHis-SUMO tag and a C-terminal Myc tag, which streamlines purification and detection steps. Purity appears to exceed 90% as verified by SDS-PAGE, providing what seems to be a reliable reagent for research applications. This product is intended for research use only.

HU-beta is a DNA-binding protein that may play a crucial role in organizing and compacting bacterial chromosomal DNA. It's known for its ability to bend DNA, which likely influences processes such as replication, transcription, and recombination. As one of the nucleoid-associated proteins, HU-beta could be significant in studies examining DNA architecture and gene regulation in prokaryotic systems.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

1. DNA-Protein Interaction Studies Using Electrophoretic Mobility Shift Assays (EMSA)

The recombinant HU-beta protein can be used to investigate its DNA-binding properties through EMSA experiments with various DNA substrates including linear, supercoiled, and damaged DNA fragments. The dual tagging system with N-terminal His-SUMO and C-terminal Myc tags allows for straightforward purification and detection during binding assays. Researchers can systematically analyze binding affinity, specificity, and cooperative binding behavior by adjusting protein concentrations against fixed DNA concentrations. This approach should provide quantitative data on the DNA-binding characteristics of Salmonella typhi HU-beta protein.

2. Antibody Development and Immunoassay Optimization

The dual-tagged recombinant protein serves as what appears to be an excellent immunogen and standard for developing specific antibodies against Salmonella typhi HU-beta. The His-SUMO and Myc tags simplify purification and enable sandwich ELISA development where anti-tag antibodies can serve as capture or detection reagents. Researchers can use this protein to screen hybridoma clones, validate antibody specificity, and establish quantitative immunoassays. The high purity level (>90%) suggests minimal cross-reactivity during antibody characterization studies.

3. Protein-Protein Interaction Mapping via Pull-Down Assays

The N-terminal His tag enables immobilization on nickel-affinity resins for pull-down experiments to identify HU-beta interacting partners from Salmonella typhi cell lysates or purified protein libraries. Meanwhile, the C-terminal Myc tag provides an additional detection method for Western blot confirmation of successful protein capture. This dual-tagging approach allows researchers to investigate the protein interaction network of HU-beta and identify potential regulatory partners or DNA-binding cofactors. Such studies may reveal insights into the molecular mechanisms of nucleoid organization in Salmonella typhi.

4. Comparative Structural and Functional Analysis

The recombinant protein can be used in comparative studies with HU proteins from other bacterial species to understand what appear to be species-specific differences in DNA-binding mechanisms. Researchers can perform side-by-side biochemical assays, circular dichroism spectroscopy, and dynamic light scattering experiments to compare structural properties and stability profiles. The standardized expression system and tagging strategy should make direct comparisons with similarly prepared HU proteins from different bacterial sources more straightforward. This approach enables systematic investigation of evolutionary relationships and functional divergence within the HU protein family.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Histone-like DNA-binding protein which is capable of wrapping DNA to stabilize it, and thus to prevent its denaturation under extreme environmental conditions.
Protein Families
Bacterial histone-like protein family
Database Links

KEGG: stt:t2409

STRING: 220341.STY0493

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*