Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

lukF

Uniprot No.

P31715

Research Area

others

Alternative Names

lukF; Leukocidin-F subunit; Gamma-hemolysin; H-gamma-I subunit

Species

Staphylococcus aureus

Source

E.coli

Expression Region

26-323aa

Target Protein Sequence

AEGKITPVSVKKVDDKVTLYKTTATADSDKFKISQILTFNFIKDKSYDKDTLVLKATGNINSGFVKPNPNDYDFSKLYWGAKYNVSISSQSNDSVNAVDYAPKNQNEEFQVQNTLGYTFGGDISISNGLSGGLNGNTAFSETINYKQESYRTLSRNTNYKNVGWGVEAHKIMNGWGPYGRDSFHPTYGNELFLAGRQSSAYAGQNFIAQHQMPLLSRSNFNPEFLSVLSHRQDRAKKSKITVTYQREMDLYQIRWNGFYWAGANYKNFKTRTFKSTYEIDWENHKVKLLDTKETENNK
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

54.0kDa

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

Amino acids 26-323 constitute the expression domain of recombinant Staphylococcus aureus lukF. This lukF protein is expected to have a theoretical molecular weight of 54 kDa. Expression of this lukF protein is conducted in e.coli. The N-terminal 10xHis-SUMO tag and C-terminal Myc tag was smoothly integrated into the coding gene of lukF, which enables a simple process of detecting and purifying the lukF recombinant protein in the following steps.

The Staphylococcus aureus leukocidin-F subunit (lukF) is one of the two subunits that make up the LukF-PV (Panton-Valentine leukocidin), a specific leukocidin associated with severe Staphylococcus aureus infections, including skin and soft tissue infections. The LukF-PV toxin is thought to form pores in the membranes of host immune cells, particularly white blood cells, disrupting their integrity and leading to cell death. This activity aids Staphylococcus aureus in evading the immune system and establishing infection. Understanding the structure and function of LukF, along with other leukocidins, is crucial for developing strategies to combat Staphylococcus aureus infections and addressing the associated pathogenicity.

Code	CSB-EP330106FKZ
Abbreviation	Recombinant Staphylococcus aureus lukF protein
MSDS	MSDS Datasheet
Size	US$388
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP330106FKZ could indicate that this peptide derived from E.coli-expressed Staphylococcus aureus lukF. Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP330106FKZ could indicate that this peptide derived from E.coli-expressed Staphylococcus aureus lukF.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Staphylococcus aureus Leukocidin-F subunit (lukF)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage