Recombinant Streptomyces avidinii Streptavidin

In Stock
Code CSB-EP332849SNO
Abbreviation Recombinant Streptomyces avidinii Streptavidin protein
MSDS
Size US$388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Uniprot No.
Research Area
Others
Alternative Names
; Streptavidin
Species
Streptomyces avidinii
Source
E.coli
Expression Region
25-183aa
Target Protein Sequence
DPSKDSKAQVSAAEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTTEANAWKSTLVGHDTFTKVKPSAASIDAAKKAGVNNGNPLDAVQQ
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
43.5kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Streptomyces avidinii Streptavidin is produced in E.coli and contains the full length mature protein, spanning amino acids 25-183. The protein carries an N-terminal GST tag for easier purification and detection. SDS-PAGE analysis confirms purity levels above 90%, which appears to make it suitable for research applications that demand high-quality protein standards.

Streptavidin from Streptomyces avidinii has gained popularity in research primarily because of its strong affinity for biotin. This interaction forms one of the strongest known non-covalent bonds. Such robust binding makes the protein particularly valuable in biochemical assays - especially those involving purification, detection, and immobilization of biotinylated molecules. The protein's ability to mediate these interactions may explain its widespread adoption in molecular biology and biotechnology research.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

1. Biotin-Binding Affinity Studies

This recombinant streptavidin works well for characterizing biotin-binding properties through in vitro binding assays and kinetic studies. The GST tag allows for straightforward purification and immobilization on glutathione-sepharose beads during binding experiments. Researchers can measure binding constants and dissociation rates, or compare binding affinities with other avidin family proteins. The >90% purity appears sufficient for reliable quantitative binding measurements using techniques such as surface plasmon resonance or fluorescence polarization assays.

2. GST Pull-Down Assay Development

The N-terminal GST tag makes this protein well-suited for developing pull-down assays to study biotin-protein interactions or biotin-modified biomolecules. Researchers can immobilize the protein on glutathione-sepharose beads and use it to capture biotinylated proteins, nucleic acids, or other biotin-conjugated molecules from complex mixtures. This approach proves valuable for studying protein-protein interactions involving biotinylated components or for purifying biotin-labeled targets from cell lysates or biochemical preparations.

3. Comparative Structural and Biochemical Analysis

This recombinant streptavidin from Streptomyces avidinii may serve as a useful research tool for comparative studies with other members of the avidin protein family. The mature protein sequence (25-183aa) expressed in E. coli provides a platform for biochemical characterization including thermal stability, pH tolerance, and resistance to proteolysis. Researchers can compare these properties with chicken avidin or other streptavidin variants to better understand structure-function relationships within this protein family.

4. Biotinylation System Validation

The protein works as a positive control and validation tool in biotinylation-based experimental systems. Its established biotin-binding capability makes it suitable for testing the efficiency of biotin conjugation reactions, validating biotinylation protocols, and serving as a standard in biotin-streptavidin detection systems. The GST tag provides an additional handle for detection and quantification, which allows researchers to optimize biotinylation conditions and troubleshoot biotin-based assay systems.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
The biological function of streptavidin is not known. Forms a strong non-covalent specific complex with biotin (one molecule of biotin per subunit of streptavidin).
Subcellular Location
Secreted.
Protein Families
Avidin/streptavidin family
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*