Recombinant Staphylococcus epidermidis Endoribonuclease MazF (mazF)

In Stock
Code CSB-EP880696FLL
Abbreviation Recombinant Staphylococcus epidermidis mazF protein
MSDS
Size US$388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP880696FLL could indicate that this peptide derived from E.coli-expressed Staphylococcus epidermidis mazF.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP880696FLL could indicate that this peptide derived from E.coli-expressed Staphylococcus epidermidis mazF.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
mazF
Uniprot No.
Research Area
Others
Alternative Names
mazF; Endoribonuclease MazF; EC 3.1.-.-; Toxin MazF; mRNA interferase MazF
Species
Staphylococcus epidermidis
Source
E.coli
Expression Region
1-120aa
Target Protein Sequence
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITDGINKAKIPTHVEIEKKKYKLDKDSVILLEQIRTLDKKRLKEKLTFLSESKMIEVDNALDISLGLNNFDHHKS
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
19.0 kDa
Protein Length
Full Length
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Tris-based buffer,50% glycerol
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Staphylococcus epidermidis Endoribonuclease MazF is produced in E. coli and includes an N-terminal 6xHis-tag that makes purification and detection more straightforward. The protein appears to be expressed as a complete construct covering amino acids 1-120. SDS-PAGE analysis confirms purity levels exceeding 90%, which suggests this product may be well-suited for research applications requiring high-quality recombinant proteins.

Endoribonuclease MazF is recognized for its RNA cleavage activity—it seems to recognize and cut RNA at particular sequences. Bacterial stress responses likely involve this enzyme, and researchers have been examining its role in pathways that regulate cell growth. MazF's capacity to target RNA makes it potentially valuable for studies focused on gene expression control and how cells respond to stress.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

1. Protein-Protein Interaction Studies Using His-Tag Affinity Purification

The N-terminal 6xHis-tag allows researchers to use nickel-based affinity purification methods for identifying possible binding partners or regulatory proteins that might interact with MazF endoribonuclease. Pull-down experiments could work with bacterial lysates or purified protein collections to capture proteins that appear to associate specifically with MazF. The >90% purity should minimize background interference from contaminating proteins during these interaction studies. This strategy might uncover components of toxin-antitoxin regulatory networks or cellular factors that could modulate MazF function.

2. Biochemical Characterization and Enzyme Kinetics Analysis

Researchers can use the purified recombinant MazF protein to develop in vitro ribonuclease activity assays with synthetic RNA substrates or bacterial RNA extracts. Optimal reaction conditions—pH, temperature, salt concentration, and cofactor requirements—can be determined through systematic testing. The high purity level should allow for precise protein quantification and what appears to be reliable kinetic parameter measurements. These studies would likely provide fundamental biochemical data on how S. epidermidis MazF endoribonuclease functions catalytically.

3. Antibody Development and Immunological Applications

The recombinant protein may serve as an effective immunogen for producing polyclonal or monoclonal antibodies specific to S. epidermidis MazF. The >90% purity should reduce cross-reactivity with other bacterial proteins during immunization procedures. Resulting antibodies could be useful for Western blotting, immunoprecipitation, or immunofluorescence studies to detect native MazF expression in bacterial cultures. The His-tag also makes it possible to develop sandwich ELISA assays for quantitative detection work.

4. Comparative Structure-Function Studies

The full-length recombinant protein (1-120aa) provides material for comparative analysis with MazF variants from other bacterial species. Proteolytic digestion experiments might map functional domains and identify regions that appear critical for ribonuclease activity. The purified protein enables systematic mutagenesis studies where researchers can modify specific amino acid residues and assess their effects on protein stability or function. Cross-species activity comparisons using standardized RNA substrates may reveal evolutionary conservation of catalytic mechanisms—though this remains to be fully established.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Toxic component of a type II toxin-antitoxin (TA) system. Ribosome-independent, sequence-specific endoribonuclease that cleaves mRNA, thus inhibiting protein synthesis and inducing bacterial stasis. It cuts between the first and nucleotides of 5'-UACAU-3' in single-stranded RNA. Neutralized by coexpression with cognate antitoxin MazE.
Protein Families
PemK/MazF family
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*