Recombinant Staphylococcus epidermidis Endoribonuclease MazF (mazF)

In Stock Promotion
Code CSB-EP880696FLL
Abbreviation Recombinant Staphylococcus epidermidis mazF protein
MSDS
Size $9.9
Promotion
CUSABIO Blowout: 4,100+ In-Stock Proteins
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP880696FLL could indicate that this peptide derived from E.coli-expressed Staphylococcus epidermidis mazF.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP880696FLL could indicate that this peptide derived from E.coli-expressed Staphylococcus epidermidis mazF.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
mazF
Uniprot No.
Research Area
Others
Alternative Names
mazF; Endoribonuclease MazF; EC 3.1.-.-; Toxin MazF; mRNA interferase MazF
Species
Staphylococcus epidermidis
Source
E.coli
Expression Region
1-120aa
Target Protein Sequence
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITDGINKAKIPTHVEIEKKKYKLDKDSVILLEQIRTLDKKRLKEKLTFLSESKMIEVDNALDISLGLNNFDHHKS
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
19.0 kDa
Protein Length
Full Length
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Tris-based buffer,50% glycerol
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Staphylococcus epidermidis Endoribonuclease MazF is produced in E. coli and includes an N-terminal 6xHis-tag that makes purification and detection more straightforward. The protein appears to be expressed as a complete construct covering amino acids 1-120. SDS-PAGE analysis confirms purity levels exceeding 90%, which suggests this product may be well-suited for research applications requiring high-quality recombinant proteins.

Endoribonuclease MazF is recognized for its RNA cleavage activity—it seems to recognize and cut RNA at particular sequences. Bacterial stress responses likely involve this enzyme, and researchers have been examining its role in pathways that regulate cell growth. MazF's capacity to target RNA makes it potentially valuable for studies focused on gene expression control and how cells respond to stress.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Staphylococcus epidermidis MazF is a bacterial toxin protein that functions as a sequence-specific endoribonuclease in toxin-antitoxin systems. The E. coli expression system is homologous to this bacterial protein, significantly increasing the probability of correct folding. MazF requires precise tertiary structure formation for its RNA cleavage activity but does not typically require complex post-translational modifications. The N-terminal 6xHis tag is small (∼2 kDa) and unlikely to sterically interfere with the protein's active site or functional domains. Therefore, this recombinant MazF has a high probability of being correctly folded and functionally active.

1. Protein-Protein Interaction Studies Using His-Tag Affinity Purification

The native bacterial expression system and small tag support authentic protein-protein interactions with minimal interference. This application is conditionally suitable but requires validation of protein folding. If properly folded, this recombinant MazF is highly suitable for studying interactions with potential regulatory partners, including its cognate antitoxin MazE. Pull-down assays can reliably identify physiological interactors involved in toxin-antitoxin regulation. The >90% purity minimizes non-specific binding. If misfolded, any interaction data is invalid.

2. Biochemical Characterization and Enzyme Kinetics Analysis

This is a priority application for validating functional activity. The protein can be used in ribonuclease assays with specific RNA substrates to determine cleavage specificity, kinetic parameters (Km, Vmax), and optimal reaction conditions. Thermal stability and pH optimum studies can characterize the enzyme's biochemical properties. Perform a pre-experiment first.

3. Antibody Development and Immunological Applications

This recombinant MazF serves as an excellent immunogen for generating specific antibodies against S. epidermidis MazF. The full-length sequence ensures comprehensive epitope coverage. The high purity (>90%) minimizes antibodies against contaminants. These antibodies will be valuable for detecting MazF expression in bacterial cultures.

4. Comparative Structure-Function Studies

This protein is ideal for comparative studies with MazF homologs from other bacterial species after its folding and activity have been validated. The properly folded, active enzyme enables meaningful functional comparisons across bacterial species and mutagenesis studies. Functional comparisons of cleavage specificity, inhibitor sensitivity, and kinetic parameters can reveal evolutionary adaptations in toxin-antitoxin systems. Site-directed mutagenesis studies can identify critical residues for catalytic activity.

Final Recommendation & Action Plan

This recombinant MazF expressed in its homologous E. coli system with a minimal His-tag is highly likely to be properly folded and functionally active, making it suitable for all proposed applications. The recommended approach is to begin with Application 2 (Biochemical Characterization) to confirm ribonuclease activity with specific RNA substrates and establish kinetic parameters. Once activity is validated, proceed confidently with Applications 1, 3, and 4 for interaction studies, antibody development, and comparative analyses. For all applications, the high purity and native folding make this reagent reliable for both structural and functional studies of bacterial toxin-antitoxin systems. 

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Toxic component of a type II toxin-antitoxin (TA) system. Ribosome-independent, sequence-specific endoribonuclease that cleaves mRNA, thus inhibiting protein synthesis and inducing bacterial stasis. It cuts between the first and nucleotides of 5'-UACAU-3' in single-stranded RNA. Neutralized by coexpression with cognate antitoxin MazE.
Protein Families
PemK/MazF family
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*