Recombinant Actinia equina DELTA-actitoxin-Aeq1a

In Stock
Code CSB-EP351109ACN
Abbreviation Recombinant Actinia equina DELTA-actitoxin-Aeq1a protein
MSDS
Size US$388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
N/A
Uniprot No.
Research Area
Others
Alternative Names
DELTA-actitoxin-Aeq1a; DELTA-AITX-Aeq1a; Equinatoxin II; EqT II; EqTII; Equinatoxin-2
Species
Actinia equina (Beadlet anemone)
Source
E.coli
Expression Region
36-214aa
Target Protein Sequence
SADVAGAVIDGASLSFDILKTVLEALGNVKRKIAVGVDNESGKTWTALNTYFRSGTSDIVLPHKVPHGKALLYNGQKDRGPVATGAVGVLAYLMSDGNTLAVLFSVPYDYNWYSNWWNVRIYKGKRRADQRMYEELYYNLSPFRGDNGWHTRNLGYGLKSRGFMNSSGHAILEIHVSKA
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
23.9 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Actinia equina DELTA-actitoxin-Aeq1a gets produced in E. coli and comes with a 6xHis-tag at the N-terminus, which makes purification much easier. The full-length mature protein covers amino acids 36 to 214 and reaches a purity level above 85%, as confirmed by SDS-PAGE. This product is meant strictly for research purposes and maintains low endotoxin levels for reliable performance across different experimental setups.

DELTA-actitoxin-Aeq1a comes from the beadlet anemone Actinia equina. It's a toxin that appears to play a role in ion channel modulation. For researchers diving into neurophysiological studies, this protein may prove quite valuable—particularly when investigating how toxins work at the cellular level. It seems to be a key tool for anyone looking into ion channel function or studying how marine toxins affect cellular processes.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Actinia equina DELTA-actitoxin-Aeq1a is a sea anemone toxin that likely requires precise folding, proper disulfide bond formation, and specific tertiary structure for its functional activity, such as ion channel modulation. The E. coli expression system may not provide the optimal oxidative environment for correct disulfide bond formation, which is critical for toxin stability and function. The N-terminal 6xHis-tag is relatively small and may cause minimal steric interference, but the probability of correct folding with functional bioactivity requires experimental validation, such as activity assays or structural analysis.

1. Protein Purification and Biochemical Characterization Studies

Basic biochemical and biophysical characterization can be performed, but results may not reflect native toxin properties if the protein is misfolded. Techniques like circular dichroism spectroscopy and dynamic light scattering can assess secondary structure and oligomerization, but disulfide bond formation needs verification. If correctly folded (validated), the protein is suitable for characterization; if misfolded (unverified), data may be misleading.

2. Antibody Development and Immunological Studies

This application is highly suitable as antibody development relies on antigenic sequence recognition rather than functional protein folding. The full-length mature protein provides comprehensive epitope coverage for generating specific antibodies. The high purity (>85%) ensures minimal contamination issues during immunization.

3. Protein-Protein Interaction Screening

This application carries a significant risk without proper folding validation. Toxin interactions with ion channels or other targets require precise tertiary structure and disulfide bonding. If correctly folded (verified), the protein may identify physiological binding partners; if misfolded/unverified, there is a high risk of non-specific binding or false negatives.

4. Comparative Toxin Structure-Function Studies

Meaningful comparative studies require native protein conformation and functional activity. If correctly folded and active (verified), the protein enables valid evolutionary and functional comparisons; if misfolded/inactive (unverified), analyses would yield misleading insights.

Final Recommendation & Action Plan

The E. coli-expressed DELTA-actitoxin-Aeq1a with a small His-tag may be folded correctly, but experimental validation is essential before functional applications. Begin with folding validation using disulfide bond analysis (e.g., mass spectrometry) and bioactivity assays (e.g., ion channel modulation tests) to confirm functionality. Application 2 (antibody development) can proceed immediately. Applications 1, 3, and 4 require rigorous folding and functional validation before use. For reliable toxin research, consider using eukaryotic expression systems or refolding protocols to ensure proper disulfide bond formation and native conformation.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Pore-forming protein that forms cations-selective hydrophilic pores of around 1 nm and causes cardiac stimulation and hemolysis. Pore formation is a multi-step process that involves specific recognition of membrane sphingomyelin (but neither cholesterol nor phosphatidylcholine) using aromatic rich region and adjacent phosphocholine (POC) binding site, firm binding to the membrane (mainly driven by hydrophobic interactions) accompanied by the transfer of the N-terminal region to the lipid-water interface and finally pore formation after oligomerization of monomers. Cytolytic effects include red blood cells hemolysis, platelet aggregation and lysis, cytotoxic and cytostatic effects on fibroblasts. Lethality in mammals has been ascribed to severe vasospasm of coronary vessels, cardiac arrhythmia, and inotropic effects.
Subcellular Location
Secreted. Nematocyst. Target cell membrane. Note=Forms an alpha-helical membrane channel in the prey.
Protein Families
Actinoporin family, Sea anemone subfamily
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*