Recombinant Actinia equina DELTA-actitoxin-Aeq1a

In Stock
Code CSB-EP351109ACN
Abbreviation Recombinant Actinia equina DELTA-actitoxin-Aeq1a protein
MSDS
Size US$388
Order now
Image
  • Warning: preg_replace(): Unknown modifier 'a' in /www/wwwroot/cusabio.com/caches/caches_template/20141113/content/show_product_protein.php on line 156
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
N/A
Uniprot No.
Research Area
Others
Alternative Names
DELTA-actitoxin-Aeq1a; DELTA-AITX-Aeq1a; Equinatoxin II; EqT II; EqTII; Equinatoxin-2
Species
Actinia equina (Beadlet anemone)
Source
E.coli
Expression Region
36-214aa
Target Protein Sequence
SADVAGAVIDGASLSFDILKTVLEALGNVKRKIAVGVDNESGKTWTALNTYFRSGTSDIVLPHKVPHGKALLYNGQKDRGPVATGAVGVLAYLMSDGNTLAVLFSVPYDYNWYSNWWNVRIYKGKRRADQRMYEELYYNLSPFRGDNGWHTRNLGYGLKSRGFMNSSGHAILEIHVSKA
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
23.9 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Actinia equina DELTA-actitoxin-Aeq1a gets produced in E. coli and comes with a 6xHis-tag at the N-terminus, which makes purification much easier. The full-length mature protein covers amino acids 36 to 214 and reaches a purity level above 85%, as confirmed by SDS-PAGE. This product is meant strictly for research purposes and maintains low endotoxin levels for reliable performance across different experimental setups.

DELTA-actitoxin-Aeq1a comes from the beadlet anemone Actinia equina. It's a toxin that appears to play a role in ion channel modulation. For researchers diving into neurophysiological studies, this protein may prove quite valuable—particularly when investigating how toxins work at the cellular level. It seems to be a key tool for anyone looking into ion channel function or studying how marine toxins affect cellular processes.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

1. Protein Purification and Biochemical Characterization Studies

This N-terminal 6xHis-tagged recombinant protein works well for refining purification protocols through nickel-affinity chromatography. It also helps establish consistent biochemical characterization methods for sea anemone toxins. Scientists can examine how stable and soluble the protein remains under different buffer conditions and pH ranges. Given its high purity (>85%), it's well-suited for thorough biophysical analyses. These might include circular dichroism spectroscopy, dynamic light scattering, and mass spectrometry—all useful for understanding folding patterns and whether the protein forms complexes.

2. Antibody Development and Immunological Studies

The recombinant DELTA-actitoxin-Aeq1a can work as an immunogen for creating both polyclonal and monoclonal antibodies that target this specific sea anemone toxin. The 6xHis tag makes it simple to attach the protein to nickel-coated surfaces for ELISA-based screening and characterization assays. These antibodies could become useful research tools for mapping where related toxins show up in Actinia equina tissues. They might also help develop detection methods for marine biology research, though their specificity would need careful validation.

3. Protein-Protein Interaction Screening

Scientists can attach the His-tagged protein to nickel-coated plates or beads for pull-down assays. This approach may help identify potential binding partners or target proteins. It seems particularly promising for studying how DELTA-actitoxin-Aeq1a might interact with membrane proteins, ion channels, or other cellular components in controlled lab conditions. The tag also allows researchers to use the protein in surface plasmon resonance studies, which can measure how quickly it binds to potential target molecules.

4. Comparative Toxin Structure-Function Studies

This recombinant protein offers a standardized reference point for comparing it with other sea anemone toxins or related cnidarian proteins. Researchers can use it to explore evolutionary connections between different actitoxin variants through sequence alignment, structural modeling, and phylogenetic analysis. Having purified protein available makes it possible to directly compare biochemical properties—thermal stability, protease sensitivity, and chemical modification patterns—across different toxin families. Though such comparisons can be challenging due to the diversity within these protein families.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Pore-forming protein that forms cations-selective hydrophilic pores of around 1 nm and causes cardiac stimulation and hemolysis. Pore formation is a multi-step process that involves specific recognition of membrane sphingomyelin (but neither cholesterol nor phosphatidylcholine) using aromatic rich region and adjacent phosphocholine (POC) binding site, firm binding to the membrane (mainly driven by hydrophobic interactions) accompanied by the transfer of the N-terminal region to the lipid-water interface and finally pore formation after oligomerization of monomers. Cytolytic effects include red blood cells hemolysis, platelet aggregation and lysis, cytotoxic and cytostatic effects on fibroblasts. Lethality in mammals has been ascribed to severe vasospasm of coronary vessels, cardiac arrhythmia, and inotropic effects.
Subcellular Location
Secreted. Nematocyst. Target cell membrane. Note=Forms an alpha-helical membrane channel in the prey.
Protein Families
Actinoporin family, Sea anemone subfamily
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*