Recombinant African swine fever virus Phosphoprotein p30 (Ba71V-93)

In Stock
Code CSB-EP335904AEJ
Abbreviation Recombinant African swine fever virus Ba71V-93 protein
MSDS
Size $388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
Ba71V-93
Uniprot No.
Research Area
Others
Alternative Names
Ba71V-93; CP204L; Phosphoprotein p30; p30; Phosphoprotein p32; p32
Species
African swine fever virus (strain Badajoz 1971 Vero-adapted) (Ba71V) (ASFV)
Source
E.coli
Expression Region
1-204aa
Target Protein Sequence
MDFILNISMKMEVIFKTDLRSSSQVVFHAGSLYNWFSVEIINSGRIVTTAIKTLLSTVKYDIVKSAHIYAGQGYTEHQAQEEWNMILHVLFEEETESSASSESIHEKNDNETNECTSSFETLFEQEPSSEEPKDSKLYMLAQKTVQHIEQYGKAPDFNKVIRAHNFIQTIHGTPLKEEEKEVVRLMVIKLLKKNKLLSHLHLMF
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
27.6 kDa
Protein Length
Full Length
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant African swine fever virus Phosphoprotein p30 (Ba71V-93) is produced in E. coli using a full-length expression that covers amino acids 1-204. The protein carries an N-terminal 6xHis tag, which makes purification and detection more straightforward. SDS-PAGE analysis confirms purity levels above 85%, indicating it should work well for various research applications. This product is designed strictly for research use and cannot be applied for diagnostic or therapeutic purposes.

Phosphoprotein p30 of the African swine fever virus appears to play a significant role in the viral replication cycle. Current research suggests it's involved in virus entry and assembly, which likely influences the virus's capacity to infect host cells. As a structural protein, p30 has become a target for investigating viral pathogenesis and immune response. This makes it potentially useful for studying African swine fever virus mechanisms and developing vaccines, though much work remains to be done.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Based on the provided information, the recombinant African swine fever virus phosphoprotein p30 is expressed in E. coli, a prokaryotic system that is generally unsuitable for producing functional eukaryotic viral proteins. ASFV p30 is a complex phosphoprotein that requires specific post-translational modifications (particularly phosphorylation) and proper folding for its biological functions in viral replication and host interaction. While the protein is full-length (1-204aa) with an N-terminal 6xHis tag and >85% purity, E. coli lacks the eukaryotic kinase machinery necessary for proper phosphorylation and the chaperone systems for correct folding of viral proteins. Since activity is unverified, the protein cannot be assumed to be correctly folded, properly modified, or bioactive without experimental validation.

1. Antibody Development and Validation

The recombinant p30 can serve as an effective immunogen for generating antibodies that recognize linear epitopes, even if the protein is misfolded or unphosphorylated. The His-tag facilitates purification and screening. However, antibodies may not recognize phosphorylation-dependent or conformational epitopes of native, properly modified p30 from ASFV-infected cells. Validation against native p30 is essential.

2. Protein-Protein Interaction Studies

This application is high-risk without folding and modification validation. While the His-tag enables technical feasibility for pull-down assays, if p30 is misfolded and unphosphorylated (as expected in E. coli), it will not interact physiologically with true binding partners. Viral phosphoproteins require specific modifications and conformations for proper interactions with host and viral proteins. Identified interactions could be non-physiological artifacts. This application should not be pursued without confirmation of proper folding and phosphorylation.

3. ELISA-Based Binding Assays

This application is feasible for antibody detection but problematic for functional studies. The His-tag enables technical development of ELISA formats, but if p30 is misfolded and unphosphorylated, binding assays will not reflect biological reality. The assay may work for antibody detection, but requires validation against properly modified p30 for accurate biological binding studies.

Final Recommendation & Action Plan

Given the high probability of improper folding and lack of essential phosphorylation in E. coli for this viral phosphoprotein, recommend first performing comprehensive validation: 1) Biophysical characterization (circular dichroism for secondary structure, size-exclusion chromatography for oligomeric state); 2) Phosphorylation status analysis using phospho-specific antibodies or mass spectrometry; 3) Functional validation using known p30 interactions if possible. Antibody development can proceed as the safest application. Avoid all functional studies (interactions, binding assays) until proper folding and modification are confirmed. For reliable p30 research, obtain the protein from eukaryotic expression systems capable of proper phosphorylation, or use ASFV-infected cell extracts as a source of native protein. Always include appropriate controls, such as known phosphorylated p30 standards, when possible.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Modifies the subcellular distribution of heterogeneous nuclear ribonucleoprotein K (HNRNPK) and may contribute to modulate HNRNPK functions related to processing and export of mRNAs during ASFV infection.
Subcellular Location
Host cytoplasm. Host nucleus.
Protein Families
Asfivirus phosphoprotein p30 family
Database Links

KEGG: vg:22220322

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*