Recombinant Ambrosia artemisiifolia Pectate lyase 1

In Stock
Code CSB-EP326746BYC
Abbreviation Recombinant Ambrosia artemisiifolia Pectate lyase 1 protein
MSDS
Size US$388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Uniprot No.
Research Area
Allergen
Alternative Names
Pectate lyase 1; EC 4.2.2.2; Antigen Amb a I; Antigen E; AgE; Pollen allergen Amb a 1.2; Protein AaBA; allergen Amb a 1.2
Species
Ambrosia artemisiifolia (Short ragweed)
Source
E.coli
Expression Region
26-398aa
Target Protein Sequence
AEDVEEFLPSANETRRSLKACEAHNIIDKCWRCKADWANNRQALADCAQGFAKGTYGGKHGDVYTVTSDKDDDVANPKEGTLRFAAAQNRPLWIIFKRNMVIHLNQELVVNSDKTIDGRGVKVNIVNAGLTLMNVKNIIIHNINIHDIKVCPGGMIKSNDGPPILRQQSDGDAINVAGSSQIWIDHCSLSKASDGLLDITLGSSHVTVSNCKFTQHQFVLLLGADDTHYQDKGMLATVAFNMFTDHVDQRMPRCRFGFFQVVNNNYDRWGTYAIGGSSAPTILSQGNRFFAPDDIIKKNVLARTGTGNAESMSWNWRTDRDLLENGAIFLPSGSDPVLTPEQKAGMIPAEPGEAVLRLTSSAGVLSCHQGAPC
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
44.8kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Ambrosia artemisiifolia Pectate lyase 1 is produced in E. coli and contains the full-length mature protein spanning amino acids 26 to 398. An N-terminal 6xHis-tag is attached to the protein, which helps with purification and detection. SDS-PAGE analysis confirms the product achieves greater than 90% purity, making it suitable for research work.

Pectate lyase 1 appears to play an important role in breaking down pectin, a major building block of plant cell walls. The enzyme works by cutting α-1,4-glycosidic bonds in pectate - a process that seems central to how plant tissues break apart and how disease develops. Scientists may find this protein particularly useful when studying plant-pathogen interactions, agricultural biotechnology, and how enzymes function.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Ambrosia artemisiifolia Pectate lyase 1 is a plant enzyme that requires precise folding, proper active site formation, and specific calcium ion coordination for its functional activity in pectin degradation. The E. coli expression system cannot provide the eukaryotic folding environment or post-translational modifications that may be important for this plant enzyme's full functionality. The N-terminal 6xHis-tag is relatively small and may cause minimal steric interference. While the full-length mature protein (26-398aa) contains all functional domains, the probability of correct folding with functional pectate lyase activity requires experimental validation, particularly regarding calcium ion binding and catalytic competence.

1. Enzyme Kinetics and Biochemical Characterization Studies

This application carries a significant risk without functional validation. Pectate lyase activity requires precise tertiary structure, calcium ion coordination, and proper active site formation. If correctly folded and active (verified through enzymatic assays), the protein may be suitable for kinetic studies. If misfolded/inactive (unverified), kinetic measurements will yield biologically meaningless results.

2. Protein-Protein Interaction Studies

This application requires proper folding validation. Pectate lyase interactions with substrates or regulatory proteins require precise tertiary structure. If correctly folded (verified), the protein may identify physiological interaction partners. If misfolded/unverified, there is a high risk of non-specific binding or failure to replicate genuine protein interactions.

3. Antibody Development and Immunological Studies

This application is highly suitable as antibody development relies on antigenic sequence recognition rather than functional enzymatic activity. The full-length mature protein provides comprehensive epitope coverage for generating antibodies against pectate lyase 1.

4. Structural Biology and Protein Folding Analysis

These studies are essential for determining folding status. Techniques should include circular dichroism spectroscopy to assess secondary structure, size-exclusion chromatography to evaluate oligomeric state, and calcium-binding assays to validate functionality. However, the His-tag may interfere with crystallization for high-resolution structural studies.

Final Recommendation & Action Plan

The E. coli expression system with a small His-tag may produce folded pectate lyase, but enzymatic functionality requires experimental validation. Begin with Application 4 (Structural Characterization) to assess folding quality through CD spectroscopy, SEC, and validate enzymatic activity using pectin substrates with calcium supplementation. Applications 1 and 2 require rigorous functional validation before proceeding. Application 3 (antibody development) can proceed immediately. For reliable pectate lyase research, always include activity controls with calcium cofactor and validate key findings with plant-expressed enzyme when possible.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Has pectate lyase activity.
Protein Families
Polysaccharide lyase 1 family, Amb a subfamily
Tissue Specificity
Pollen and flowers.
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*