Recombinant Ambrosia artemisiifolia Pectate lyase 1

In Stock
Code CSB-EP326746BYC
Abbreviation Recombinant Ambrosia artemisiifolia Pectate lyase 1 protein
MSDS
Size US$388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Uniprot No.
Research Area
Allergen
Alternative Names
Pectate lyase 1; EC 4.2.2.2; Antigen Amb a I; Antigen E; AgE; Pollen allergen Amb a 1.2; Protein AaBA; allergen Amb a 1.2
Species
Ambrosia artemisiifolia (Short ragweed)
Source
E.coli
Expression Region
26-398aa
Target Protein Sequence
AEDVEEFLPSANETRRSLKACEAHNIIDKCWRCKADWANNRQALADCAQGFAKGTYGGKHGDVYTVTSDKDDDVANPKEGTLRFAAAQNRPLWIIFKRNMVIHLNQELVVNSDKTIDGRGVKVNIVNAGLTLMNVKNIIIHNINIHDIKVCPGGMIKSNDGPPILRQQSDGDAINVAGSSQIWIDHCSLSKASDGLLDITLGSSHVTVSNCKFTQHQFVLLLGADDTHYQDKGMLATVAFNMFTDHVDQRMPRCRFGFFQVVNNNYDRWGTYAIGGSSAPTILSQGNRFFAPDDIIKKNVLARTGTGNAESMSWNWRTDRDLLENGAIFLPSGSDPVLTPEQKAGMIPAEPGEAVLRLTSSAGVLSCHQGAPC
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
44.8kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Ambrosia artemisiifolia Pectate lyase 1 is produced in E. coli and contains the full-length mature protein spanning amino acids 26 to 398. An N-terminal 6xHis-tag is attached to the protein, which helps with purification and detection. SDS-PAGE analysis confirms the product achieves greater than 90% purity, making it suitable for research work.

Pectate lyase 1 appears to play an important role in breaking down pectin, a major building block of plant cell walls. The enzyme works by cutting α-1,4-glycosidic bonds in pectate - a process that seems central to how plant tissues break apart and how disease develops. Scientists may find this protein particularly useful when studying plant-pathogen interactions, agricultural biotechnology, and how enzymes function.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

1. Enzyme Kinetics and Biochemical Characterization Studies

Scientists can use this recombinant pectate lyase 1 from Ambrosia artemisiifolia to study how plant pectate lyases work through laboratory substrate breakdown tests. Researchers might determine the best pH, temperature, and salt conditions for enzyme activity using pectin or pectate as starting materials. The high purity (>90%) and N-terminal His-tag make purification and measurement more straightforward for accurate kinetic studies. This work could help reveal how ragweed pectate lyases compare to those found in other plants.

2. Protein-Protein Interaction Studies

The N-terminal 6xHis-tag allows for pull-down experiments to find potential binding partners or helper molecules that work with this pectate lyase. Scientists can attach the recombinant protein to nickel-coated beads and mix it with plant cell extracts or protein collections to grab onto interacting molecules. Mass spectrometry analysis of these captured complexes might uncover new regulatory proteins or enzyme modifiers. This strategy could shed light on the molecular mechanisms that control how pectate lyase modifies plant cell walls.

3. Antibody Development and Immunological Studies

This purified recombinant protein works well as an antigen for creating specific antibodies against Ambrosia artemisiifolia pectate lyase 1 in laboratory animals. The high purity and known protein sequence should give consistent results when producing polyclonal or monoclonal antibodies. Scientists can test these antibodies using ELISA, Western blot, or immunofluorescence methods with the His-tagged recombinant protein serving as a positive control. Such research-grade antibodies would make it possible to detect and locate native pectate lyase in ragweed plant tissues.

4. Structural Biology and Protein Folding Analysis

Researchers can study this recombinant protein's structure using techniques like circular dichroism spectroscopy, dynamic light scattering, and analytical ultracentrifugation to examine protein folding, stability, and whether multiple protein units stick together. X-ray crystallography or NMR studies could reveal the three-dimensional structure of this ragweed pectate lyase. The His-tag helps purify the protein to the high concentrations that structural biology methods typically require. These investigations may provide insights into the molecular shape and folding characteristics unique to Ambrosia artemisiifolia pectate lyases.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Has pectate lyase activity.
Protein Families
Polysaccharide lyase 1 family, Amb a subfamily
Tissue Specificity
Pollen and flowers.
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*