Recombinant Ambrosia artemisiifolia Pectate lyase 5

In Stock
Code CSB-YP329754BYC
Abbreviation Recombinant Ambrosia artemisiifolia Pectate lyase 5 protein
MSDS
Size $436
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Uniprot No.
Research Area
Others
Alternative Names
Pectate lyase 5; EC 4.2.2.2; Antigen Amb a I; Antigen E; AgE; Pollen allergen Amb a 1.1; allergen Amb a 1.1
Species
Ambrosia artemisiifolia (Short ragweed)
Source
Yeast
Expression Region
26-396aa
Target Protein Sequence
AEDLQEILPVNETRRLTTSGAYNIIDGCWRGKADWAENRKALADCAQGFGKGTVGGKDGDIYTVTSELDDDVANPKEGTLRFGAAQNRPLWIIFERDMVIRLDKEMVVNSDKTIDGRGAKVEIINAGFTLNGVKNVIIHNINMHDVKVNPGGLIKSNDGPAAPRAGSDGDAISISGSSQIWIDHCSLSKSVDGLVDAKLGTTRLTVSNSLFTQHQFVLLFGAGDENIEDRGMLATVAFNTFTDNVDQRMPRCRHGFFQVVNNNYDKWGSYAIGGSASPTILSQGNRFCAPDERSKKNVLGRHGEAAAESMKWNWRTNKDVLENGAIFVASGVDPVLTPEQSAGMIPAEPGESALSLTSSAGVLSCQPGAPC
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
41.8 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Ambrosia artemisiifolia Pectate lyase 5 is expressed in a yeast system and includes a full-length mature protein corresponding to amino acids 26-396. The protein is engineered with an N-terminal 6xHis tag, which makes purification and detection more straightforward. It shows purity greater than 90% as verified by SDS-PAGE, likely ensuring reliable performance for research applications.

Pectate lyase 5 from Ambrosia artemisiifolia is an enzyme involved in the breakdown of pectin, a major component of the plant cell wall. This protein appears to play a crucial role in plant tissue degradation and may be of interest in research focused on plant pathology and allergen studies, given the importance of its source species, short ragweed, in allergenic responses.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Based on the provided information, recombinant Ambrosia artemisiifolia Pectate lyase 5 is produced in a yeast expression system as the full-length mature protein (26-396aa) with an N-terminal 6xHis-tag. Yeast expression systems provide eukaryotic folding machinery capable of supporting disulfide bond formation and some post-translational modifications, which are important for the structural integrity and function of enzymes like pectate lyase. The full-length nature of the protein increases the probability of correct folding. However, the N-terminal His-tag may potentially interfere with protein folding or enzymatic activity, particularly if the N-terminal region is critical for function. Purity >90% by SDS-PAGE is determined under denaturing conditions and does not confirm native folding or bioactivity. No validation data (e.g., enzymatic activity assays, circular dichroism) are provided. Therefore, while yeast expression suggests a reasonable chance of correct folding, the protein's folding status and bioactivity cannot be confirmed without experimental validation.

1. Enzyme Kinetics and Biochemical Characterization Studies

Pectate lyase activity depends on precise folding and active site formation; misfolding would render kinetic data biologically irrelevant. If correctly folded, this recombinant pectate lyase 5 can be used to study enzymatic properties such as substrate specificity and kinetic parameters using pectate substrates. However, if misfolded, enzymatic assays would yield invalid results, as the active site may be disrupted. The His-tag might also affect enzyme activity or substrate binding, so validation of activity is essential before quantitative studies.

2. Comparative Enzyme Evolution and Structure-Function Analysis

Comparative analyses require native folding to ensure valid insights into enzyme evolution and function. If properly folded, the protein is suitable for comparative studies with pectate lyases from other species to understand evolutionary adaptations. However, if misfolded, any structural or functional comparisons would be misleading, as the data would not represent the native protein. The His-tag should be considered when interpreting structural data, as it may influence biophysical measurements.

3. His-Tag Affinity Purification and Protein Interaction Studies

Protein-protein interactions depend on native conformation; misfolding compromises binding specificity. The His-tag facilitates purification and can be used for pull-down assays to identify interaction partners, such as cell wall components. However, if the protein is misfolded, interaction domains may be altered, leading to non-specific binding or failure to recognize genuine partners. Even if folded, the tag might sterically hinder some interactions.

4. Antibody Development and Immunological Research

Antibodies can be generated against linear sequences, but conformational epitopes may be misrepresented if the protein is misfolded. This application is suitable as antibody generation primarily relies on linear epitope recognition, which is independent of folding status. The high purity and full-length sequence support consistent antibody production. However, if misfolded, antibodies may not optimally recognize conformational epitopes of the native protein in biological contexts.

Final Recommendation & Action Plan

Before using this recombinant pectate lyase 5 in any functional application, it is essential to validate its folding and bioactivity through enzymatic assays (e.g., using pectate substrates to confirm activity) and biophysical methods (e.g., circular dichroism for secondary structure analysis); if validation confirms proper folding and function, proceed with applications while considering the potential impact of the His-tag on enzyme kinetics and interactions; if misfolded or inactive, consider using tag-free protein or alternative expression systems for better results; for immediate use, antibody development can proceed, but validate antibodies against native protein; always include appropriate controls (e.g., known active enzymes, substrate blanks) in experiments to ensure reliability.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Has pectate lyase activity.
Protein Families
Polysaccharide lyase 1 family, Amb a subfamily
Tissue Specificity
Pollen and flowers.
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*