Recombinant Ambrosia artemisiifolia Pectate lyase 5

In Stock
Code CSB-YP329754BYC
Abbreviation Recombinant Ambrosia artemisiifolia Pectate lyase 5 protein
MSDS
Size $436
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Uniprot No.
Research Area
Others
Alternative Names
Pectate lyase 5; EC 4.2.2.2; Antigen Amb a I; Antigen E; AgE; Pollen allergen Amb a 1.1; allergen Amb a 1.1
Species
Ambrosia artemisiifolia (Short ragweed)
Source
Yeast
Expression Region
26-396aa
Target Protein Sequence
AEDLQEILPVNETRRLTTSGAYNIIDGCWRGKADWAENRKALADCAQGFGKGTVGGKDGDIYTVTSELDDDVANPKEGTLRFGAAQNRPLWIIFERDMVIRLDKEMVVNSDKTIDGRGAKVEIINAGFTLNGVKNVIIHNINMHDVKVNPGGLIKSNDGPAAPRAGSDGDAISISGSSQIWIDHCSLSKSVDGLVDAKLGTTRLTVSNSLFTQHQFVLLFGAGDENIEDRGMLATVAFNTFTDNVDQRMPRCRHGFFQVVNNNYDKWGSYAIGGSASPTILSQGNRFCAPDERSKKNVLGRHGEAAAESMKWNWRTNKDVLENGAIFVASGVDPVLTPEQSAGMIPAEPGESALSLTSSAGVLSCQPGAPC
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
41.8 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Ambrosia artemisiifolia Pectate lyase 5 gets expressed in a yeast system and includes a full-length mature protein corresponding to amino acids 26-396. The protein is engineered with an N-terminal 6xHis tag, which makes purification and detection more straightforward. It shows purity greater than 90% as verified by SDS-PAGE, likely ensuring reliable performance for research applications.

Pectate lyase 5 from Ambrosia artemisiifolia is an enzyme involved in the breakdown of pectin, a major component of the plant cell wall. This protein appears to play a crucial role in plant tissue degradation and may be of interest in research focused on plant pathology and allergen studies, given the importance of its source species, short ragweed, in allergenic responses.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

1. Enzyme Kinetics and Biochemical Characterization Studies

This recombinant pectate lyase 5 from Ambrosia artemisiifolia can be used to investigate the enzymatic properties and kinetic parameters of plant pectate lyases through in vitro assays. Researchers might determine substrate specificity, optimal pH and temperature conditions, and catalytic efficiency using various pectate substrates. The high purity (>90%) and N-terminal His-tag make purification and handling easier for detailed biochemical analysis. Such studies would likely contribute to understanding the role of pectate lyases in plant cell wall modification and ragweed biology.

2. Comparative Enzyme Evolution and Structure-Function Analysis

The protein could serve as a valuable tool for comparative studies examining pectate lyase evolution across different plant species, particularly within the Asteraceae family. Researchers might compare its enzymatic properties, substrate preferences, and structural features with pectate lyases from other plants to understand evolutionary adaptations. The recombinant protein allows controlled comparative experiments that would be difficult to perform with native plant extracts. This application may support broader research into plant cell wall enzyme diversity and functional specialization.

3. His-Tag Affinity Purification and Protein Interaction Studies

The N-terminal 6xHis-tag allows for straightforward purification using nickel affinity chromatography and makes pull-down experiments possible to identify potential protein interaction partners. Researchers can use this tagged protein in binding assays with plant cell wall components or other proteins involved in cell wall metabolism. The tag also allows for easy detection and quantification in various experimental setups, making it suitable for studying protein-protein or protein-substrate interactions in controlled in vitro systems.

4. Antibody Development and Immunological Research

This highly purified recombinant protein may serve as an excellent antigen for generating specific antibodies against Ambrosia artemisiifolia pectate lyase 5. The resulting antibodies could be used in various research applications including Western blotting, immunohistochemistry, and ELISA-based detection systems for studying ragweed biology. The recombinant nature ensures consistent antigen quality and availability for immunization protocols, while the high purity appears to minimize cross-reactivity with other proteins during antibody development.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Has pectate lyase activity.
Protein Families
Polysaccharide lyase 1 family, Amb a subfamily
Tissue Specificity
Pollen and flowers.
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*