Recombinant Amylomyces rouxii Chitin deacetylase

In Stock
Code CSB-EP344641AJI
Abbreviation Recombinant Amylomyces rouxii Chitin deacetylase protein
MSDS
Size US$388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
CDA
Uniprot No.
Research Area
Others
Alternative Names
Chitin deacetylase; EC 3.5.1.41
Species
Amylomyces rouxii(Filamentous fungus)(Mucor rouxii)
Source
E.coli
Expression Region
22-421aa
Target Protein Sequence
DTSANYWQSFTSQINPKNISIPSIEQTSSIDPTQECAYYTPDASLFTFNASEWPSIWEVATTNGMNESAEFLSVYNSIDWTKAPNISVRTLDANGNLDTTGYNTATDPDCWWTATTCTSPKISDINDDISKCPEPETWGLTYDDGPNCSHNAFYDYLQEQKLKASMFYIGSNVVDWPYGAMRGVVDGHHIASHTWSHPQMTTKTNQEVLAEFYYTQKAIKLATGLTPRYWRPPYGDIDDRVRWIASQLGLTAVIWNLDTDDWSAGVTTTVEAVEQSYSDYIAMGTNGTFANSGNIVLTHEINTTMSLAVENLPKIISAYKQVIDVATCYNISHPYFEDYEWTNVLNGTKSSATASGSATSASASGGATTAAAHIQASTSGAMSVLPNLALISAFIATLLF
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
49.9 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The synthesis of recombinant Amylomyces rouxii Chitin deacetylase involves isolating the target gene, which encodes the full length of the mature chitin deacetylase. This gene is linked with a10xHis-tag gene at the N-terminus and then cloned into an appropriate expression vector. The vector is transfected into E. coli cells, which are cultured for the expression of the recombinant protein. The recombinant protein is isolated and purified from the cell lysate using affinity chromatography. Its purity exceeds 85% as determined by SDS-PAGE.

Chitin deacetylase is an enzyme that catalyzes the deacetylation of chitin, a structural biopolymer found in various marine life forms, fungal cell walls, spores, insect cuticles, and peritrophic matrices [1]. The deacetylation process carried out by chitin deacetylases, such as the one found in Amylomyces rouxii, involves the hydrolysis of N-acetamido groups of N-acetyl-D-glucosamine residues in chitin [2]. Chitin deacetylases, including those found in Amylomyces rouxii, are essential for cell wall morphogenesis and remodeling in fungi and bacteria [3]. They are also used by pathogenic microorganisms to evade host defense [3].

References:
[1] Z. Yong, R. Park, & R. Müzzarelli, Chitin deacetylases: properties and applications, Marine Drugs, vol. 8, no. 1, p. 24-46, 2010. https://doi.org/10.3390/md8010024
[2] C. Mishra, C. Semino, K. McCreath, H. Vega, B. Jones, C. Spechtet al., Cloning and expression of two chitin deacetylase genes ofsaccharomyces cerevisiae, Yeast, vol. 13, no. 4, p. 327-336, 1997. https://doi.org/10.1002/(sici)1097-0061(19970330)13:43.0.co;2-t
[3] H. Aragunde, X. Biarnés, & A. Planas, Substrate recognition and specificity of chitin deacetylases and related family 4 carbohydrate esterases, International Journal of Molecular Sciences, vol. 19, no. 2, p. 412, 2018. https://doi.org/10.3390/ijms19020412

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Hydrolyzes the N-acetamido groups of N-acetyl-D-glucosamine residues in chitin to form chitosan and acetate.
Subcellular Location
Secreted, cell wall. Cell membrane; Lipid-anchor, GPI-anchor.
Protein Families
Polysaccharide deacetylase family
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*