Recombinant Anas platyrhynchos Lysozyme C-1

In Stock
Code CSB-EP360572BZD
Abbreviation Recombinant Anas platyrhynchos Lysozyme C-1 protein
MSDS
Size US$388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Uniprot No.
Research Area
Others
Alternative Names
Lysozyme C-1; EC 3.2.1.17; 1,4-beta-N-acetylmuramidase C
Species
Anas platyrhynchos (Mallard) (Anas boschas)
Source
E.coli
Expression Region
19-147aa
Target Protein Sequence
KVYSRCELAAAMKRLGLDNYRGYSLGNWVCAANYESGFNTQATNRNTDGSTDYGILQINSRWWCDNGKTPRSKNACGIPCSVLLRSDITEAVRCAKRIVSDGDGMNAWVAWRNRCRGTDVSKWIRGCRL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
32.4kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Anas platyrhynchos Lysozyme C-1 is produced using an E. coli expression system and includes a full-length mature protein spanning amino acids 19-147. The protein comes with an N-terminal 6xHis-SUMO tag to make purification and detection easier. SDS-PAGE analysis shows it reaches greater than 90% purity. This product is meant for research use only and appears to offer consistent quality for various experimental applications.

Lysozyme C-1 likely plays a crucial role in how Anas platyrhynchos defends itself by showing antibacterial activity. The protein works by breaking down the peptidoglycan layer of bacterial cell walls - something that's essential for keeping cell wall integrity intact. This makes it valuable for research focused on innate immunity and microbial interactions, potentially offering insights into how immune systems evolved across different species.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

1. Comparative Lysozyme Structure-Function Studies

This recombinant mallard lysozyme C-1 could serve as a useful tool for comparative studies looking at lysozyme evolution and how structures differ between species. The N-terminal His-SUMO tag makes purification straightforward and allows for immobilization during biochemical characterization experiments. Scientists can compare this avian lysozyme with versions from mammals and other bird species to better understand evolutionary adaptations. With >90% purity, it seems well-suited for detailed biochemical analysis and comparative enzyme kinetics studies.

2. Antibody Development and Immunological Research

The recombinant protein may work as an immunogen for creating specific antibodies against mallard lysozyme C-1, or it could function as a standard in immunoassays. The His-SUMO tag helps with purification and can be used in tag-based detection systems - though it can also be removed if researchers need the native protein. This application appears particularly valuable for wildlife immunology research and developing tools to study lysozyme expression in waterfowl species. The high purity level suggests minimal cross-reactivity with other proteins during antibody production.

3. Protein-Protein Interaction Studies

Researchers can use the His-tagged lysozyme in pull-down assays to identify potential binding partners or substrates from mallard tissue extracts or other biological samples. The SUMO tag might also help with protein folding and stability during interaction studies. Scientists could investigate lysozyme's role beyond antimicrobial activity - perhaps looking at interactions with other immune system components. The tag system makes immobilization on affinity matrices relatively simple for systematic interaction screening.

4. Biochemical Characterization and Enzyme Assays

Even though biological activity testing hasn't been confirmed, this recombinant lysozyme could help establish and optimize activity assays specific for mallard lysozyme C-1. Researchers might test various substrates and conditions to characterize the enzyme's biochemical properties, including pH and temperature optima. The protein could serve as a reference standard for developing lysozyme activity assays in avian research. The high purity level suggests it would give reliable and reproducible results in biochemical characterization experiments.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Lysozymes have primarily a bacteriolytic function; those in tissues and body fluids are associated with the monocyte-macrophage system and enhance the activity of immunoagents.
Subcellular Location
Secreted.
Protein Families
Glycosyl hydrolase 22 family
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*