Recombinant Anemonia sulcata GFP-like non-fluorescent chromoprotein FP595

In Stock
Code CSB-EP887932AKE
Abbreviation Recombinant Anemonia sulcata GFP-like non-fluorescent chromoprotein FP595 protein
MSDS
Size $388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
N/A
Uniprot No.
Research Area
Biochemicals
Alternative Names
asFP595
Species
Anemonia sulcata (Mediterranean snakelocks sea anemone)
Source
E.coli
Expression Region
1–62aa
Target Protein Sequence
MASFLKKTMPFKTTIEGTVNGHYFKCTGKGEGNPFEGTQEMKIEVIEGGPLPFAFHILSTSC
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
33.5 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Anemonia sulcata GFP-like non-fluorescent chromoprotein FP595 is produced in E. coli, spanning the complete mature protein sequence from amino acids 1 to 62. The protein carries an N-terminal GST tag and shows purity levels exceeding 85% when analyzed by SDS-PAGE. This product is designed exclusively for research purposes and lacks fluorescence properties while maintaining low endotoxin concentrations suitable for experimental work.

FP595 represents a GFP-like chromoprotein sourced from the Mediterranean snakelocks sea anemone, Anemonia sulcata. What sets this protein apart from its fluorescent relatives is its complete lack of fluorescence, which may make it particularly valuable across different research contexts. The distinctive chromophore characteristics appear to be well-suited for studies examining protein interactions, stability testing, and serving as a control in experiments requiring non-fluorescent markers.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Based on the provided information, the recombinant FP595 chromoprotein is unlikely to be correctly folded or bioactive without experimental validation. GFP-like proteins require precise folding to form a functional chromophore, which involves cyclization and oxidation reactions that may not occur properly in the E. coli expression system. The large N-terminal GST tag (∼26 kDa) is substantially larger than the FP595 domain (∼7 kDa, 62 aa) and may sterically hinder correct folding, particularly if the chromophore formation requires accessibility of the N-terminal region.

1. Protein Expression and Purification Optimization Studies

This GST-tagged chromoprotein can be used as a model for optimizing expression and purification protocols in E. coli, as this application primarily relies on the GST tag's affinity properties rather than protein functionality. However, if the protein is misfolded, it may not serve as an accurate representative for other fluorescent/chromoproteins, as folding conditions could differ. For reliable protocol development, include validation of chromophore formation or use a well-characterized control protein.

2. Antibody Development and Validation

This recombinant protein can generate antibodies, but if misfolded, antibodies may recognize non-native epitopes or the GST tag rather than the native chromoprotein. For antibodies specific to natural FP595, validate using correctly folded protein or endogenous material from Anemonia sulcata. The high purity reduces contamination risks but does not ensure antigen quality.

Final Recommendation & Action Plan

To ensure reliable results, first validate the folding and chromophore formation of the recombinant FP595 using absorption spectroscopy (e.g., check for the characteristic ∼595 nm peak) and circular dichroism to confirm secondary structure. If the GST tag is suspected to interfere, remove it via proteolytic cleavage (if a cleavage site is present) and re-purify the tag-free protein for functional studies. For applications like antibody development or interaction assays, always include controls such as GST-only proteins or well-folded chromoprotein standards. If folding cannot be verified, limit use to tag-based applications (e.g., purification optimization) and avoid functional or comparative studies.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Pigment protein that is intensely purple in color.
Protein Families
GFP family
Tissue Specificity
Tentacle tips.
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*