Recombinant Anemonia sulcata GFP-like non-fluorescent chromoprotein FP595

In Stock
Code CSB-EP887932AKE
Abbreviation Recombinant Anemonia sulcata GFP-like non-fluorescent chromoprotein FP595 protein
MSDS
Size $388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
N/A
Uniprot No.
Research Area
Biochemicals
Alternative Names
asFP595
Species
Anemonia sulcata (Mediterranean snakelocks sea anemone)
Source
E.coli
Expression Region
1–62aa
Target Protein Sequence
MASFLKKTMPFKTTIEGTVNGHYFKCTGKGEGNPFEGTQEMKIEVIEGGPLPFAFHILSTSC
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
33.5 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Anemonia sulcata GFP-like non-fluorescent chromoprotein FP595 is produced in E. coli, spanning the complete mature protein sequence from amino acids 1 to 62. The protein carries an N-terminal GST tag and shows purity levels exceeding 85% when analyzed by SDS-PAGE. This product is designed exclusively for research purposes and lacks fluorescence properties while maintaining low endotoxin concentrations suitable for experimental work.

FP595 represents a GFP-like chromoprotein sourced from the Mediterranean snakelocks sea anemone, Anemonia sulcata. What sets this protein apart from its fluorescent relatives is its complete lack of fluorescence, which may make it particularly valuable across different research contexts. The distinctive chromophore characteristics appear to be well-suited for studies examining protein interactions, stability testing, and serving as a control in experiments requiring non-fluorescent markers.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

1. Protein Expression and Purification Optimization Studies

This GST-tagged chromoprotein appears to function as an effective model system for refining expression conditions and purification methods for marine-derived fluorescent proteins in E. coli systems. The N-terminal GST tag allows for affinity purification through glutathione-based resins, which seems ideal for testing different buffer compositions, temperature settings, and purification approaches. Scientists might find this protein helpful for establishing standardized protocols when working with other Anemonia sulcata fluorescent protein variants or similar cnidarian chromoproteins.

2. GST-Tagged Protein Interaction Assays

The GST tag creates opportunities for pull-down experiments aimed at identifying potential protein binding partners or confirming known interactions within controlled in vitro environments. Researchers can immobilize the chromoprotein on glutathione beads and capture interacting proteins from cell lysates or purified protein solutions. This approach could prove particularly valuable when studying protein-protein interactions involving chromophore-containing proteins or when developing binding assays where the chromoprotein acts as bait.

3. Chromophore Formation and Maturation Studies

Being a non-fluorescent chromoprotein from Anemonia sulcata, this recombinant protein offers a chance to examine chromophore formation mechanisms and maturation processes within the marine-derived fluorescent protein family. Scientists may investigate which biochemical conditions influence chromophore development, analyze spectral properties of the mature chromoprotein, and compare maturation rates with other GFP-like proteins. The purified protein allows for controlled investigations of factors that might affect chromophore chemistry without the complications of cellular environments.

4. Antibody Development and Validation

The recombinant chromoprotein could function as an antigen for producing specific antibodies against Anemonia sulcata FP595 or related chromoproteins. Its high purity level (>85%) suggests it would work well in immunization protocols and subsequent antibody characterization experiments. Such antibodies might become useful research tools for detecting natural chromoproteins in Anemonia sulcata tissues or for examining distribution and expression patterns of similar proteins across cnidarian species.

5. Comparative Structural and Biochemical Analysis

This purified chromoprotein opens doors for comparative studies with other GFP-like protein family members to better understand what structural elements determine fluorescence versus non-fluorescence properties. Scientists can conduct biochemical characterization including thermal stability testing, pH sensitivity analysis, and spectroscopic examination to identify what distinguishes this non-fluorescent variant from its fluorescent cousins. The GST tag helps ensure consistent purification for reliable comparative analyses across various experimental conditions.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Pigment protein that is intensely purple in color.
Protein Families
GFP family
Tissue Specificity
Tentacle tips.
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*