Recombinant Arabidopsis thaliana Glutamine synthetase, chloroplastic/mitochondrial (GLN2)

In Stock
Code CSB-EP674854DOA
Abbreviation Recombinant Mouse-ear cress GLN2 protein
MSDS
Size $256
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 95% as determined by SDS-PAGE.
Activity
Not Test
Target Names
GLN2
Uniprot No.
Research Area
Others
Alternative Names
GS2;Glutamate--ammonia ligase
Species
Arabidopsis thaliana (Mouse-ear cress)
Source
E.coli
Expression Region
46-430aa
Target Protein Sequence
GFRVLALQSDNSTVNRVETLLNLDTKPYSDRIIAEYIWIGGSGIDLRSKSRTIEKPVEDPSELPKWNYDGSSTGQAPGEDSEVILYPQAIFRDPFRGGNNILVICDTWTPAGEPIPTNKRAKAAEIFSNKKVSGEVPWFGIEQEYTLLQQNVKWPLGWPVGAFPGPQGPYYCGVGADKIWGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIDAGDHVWCARYLLERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHKEHISAYGEGNERRLTGKHETASIDQFSWGVANRGCSIRVGRDTEAKGKGYLEDRRPASNMDPYIVTSLLAETTLLWEPTLEAEALAAQKLSLNV
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
49.4 kDa
Protein Length
Full Length of Mature Protein
Tag Info
C-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Arabidopsis thaliana Glutamine synthetase, chloroplastic/mitochondrial (GLN2) is produced in E. coli and includes the mature protein length from amino acids 46 to 430. The product contains a C-terminal 6xHis tag, which allows for straightforward purification and detection. SDS-PAGE analysis confirms purity levels above 95%, suggesting this represents high-quality protein for research work.

Glutamine synthetase, chloroplastic/mitochondrial (GLN2), appears to be a crucial enzyme in nitrogen metabolism. It catalyzes the ATP-dependent conversion of glutamate and ammonia to glutamine. This protein likely plays an important role in nitrogen assimilation—a key process for plant growth and development. Research on this enzyme may provide insights into nitrogen use pathways and how plants respond to stress, which could be significant for agricultural and environmental studies.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Based on the provided information, the folding state and bioactivity of this recombinant GLN2 protein are unknown and cannot be assumed. Glutamine synthetase is a complex, multi-subunit enzyme that requires precise folding and often metal cofactors for activity. While the protein represents the mature sequence (46-430aa) and has high purity (>95%), expression in E. coli does not guarantee correct folding for a eukaryotic, organellar-targeted protein. The C-terminal His-tag may also potentially influence oligomerization or activity. Therefore, any application that depends on the protein's specific enzymatic activity or native quaternary structure is speculative without experimental validation.

1. Protein-Protein Interaction Studies Using His-Tag Pull-Down Assays

The C-terminal 6xHis tag allows this recombinant GLN2 to be immobilized for pull-down assays to identify potential binding partners from plant extracts. The high purity (>95%) is beneficial for reducing background. However, a critical caveat is that any interactions detected are contingent upon the recombinant protein being correctly folded and assembled into its native oligomeric state. If the protein is misfolded or cannot form proper complexes, it may not present the correct surfaces for interaction, leading to false negatives or non-specific binding. The results must be interpreted with caution and confirmed with complementary methods.

2. Antibody Development and Validation

The high-purity recombinant GLN2 protein is suitable for use as an immunogen to generate specific antibodies. The mature protein sequence increases the likelihood that antibodies will recognize the endogenous enzyme. However, it is important to note that antibodies generated will primarily recognize linear epitopes. Their ability to bind the natively folded, oligomeric, and potentially post-translationally modified GLN2 enzyme in Arabidopsis chloroplasts or mitochondria is not guaranteed and requires empirical validation (e.g., using plant tissue extracts). The recombinant GLN2 protein is excellent for initial antibody screening and validation in techniques like Western blotting.

3. Biochemical Characterization and Enzyme Kinetics Analysis

This recombinant GLN2 protein is a necessary starting point for biochemical characterization. The primary and essential first step is to subject the protein to activity assays using glutamate, ammonia, and ATP as substrates to determine if the recombinant enzyme is functional. Only if catalytic activity is confirmed can subsequent studies on kinetics, pH/temperature optima, and inhibitor sensitivity be meaningfully pursued. The high purity is a prerequisite for reliable assays, but does not substitute for activity confirmation.

4. Comparative Structural and Functional Studies

The recombinant GLN2 protein can serve as a standard for comparative studies. The viability of this application is entirely dependent on the outcome of initial activity tests. Side-by-side analysis of enzymatic properties is only possible if this protein is first shown to be active. If inactive, its utility for functional comparisons is null. However, it could still be used for comparative structural studies (e.g., circular dichroism spectroscopy) or as a standard in immunoblots across species, independent of activity.

Final Recommendation & Action Plan

The immediate and imperative first step is to perform a standard glutamine synthetase activity assay (e.g., the biosynthetic or transferase assay) to confirm the enzyme's functionality before investing resources in most proposed applications. The outcome of this test is critical: a positive result would validate the use of the protein in kinetic studies (Application 3), meaningful interaction studies (Application 1), and functional comparisons (Application 4). A negative result would limit its utility primarily to Application 2 (antibody production, with the noted caveat about native protein recognition) and non-functional comparative studies. Therefore, the activity assay is not just an option but a prerequisite for interpreting data from any functional experiment correctly.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
The light-modulated chloroplast/mitochondrial enzyme, encoded by a nuclear gene and expressed primarily in leaves, is responsible for the reassimilation of the ammonia generated by photorespiration.
Gene References into Functions
  1. ACR11 is an activator of GS2. PMID: 28339983
  2. Drop in mRNA levels for GLN2 and GLN1 by salt was associated with a similar inhibition of glutamine synthetase activity in leaves of Arabidopsis thaliana. In roots, NaCl stress was found to enhance mRNA levels of GLN2 and cytosolic-encoding genes. PMID: 23122335
Subcellular Location
Plastid, chloroplast. Mitochondrion.
Protein Families
Glutamine synthetase family
Tissue Specificity
Expressed in mesophyll and epidermal cells of leaves.
Database Links

KEGG: ath:AT5G35630

STRING: 3702.AT5G35630.1

UniGene: At.24218

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*