Recombinant Bacillus subtilis Penicillin-binding protein 4 (pbpD), partial

In Stock
Code CSB-EP334764BRJ
Abbreviation Recombinant Bacillus subtilis pbpD protein, partial
MSDS
Size US$388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP334764BRJ could indicate that this peptide derived from E.coli-expressed Bacillus subtilis (strain 168) pbpD.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP334764BRJ could indicate that this peptide derived from E.coli-expressed Bacillus subtilis (strain 168) pbpD.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
pbpD
Uniprot No.
Research Area
others
Alternative Names
pbpD; BSU31490; Penicillin-binding protein 4; PBP 4) [Includes: Penicillin-insensitive transglycosylase; EC 2.4.1.129; Peptidoglycan TGase); Penicillin-sensitive transpeptidase; EC 3.4.16.4; DD-transpeptidase)]
Species
Bacillus subtilis (strain 168)
Source
E.coli
Expression Region
213-450aa
Target Protein Sequence
PNNPTLYDPLKHFDYTKSRQERLLKGLKDAGVITDKELKKAVKQKIKLDVEKREDKYPDYVSYVNDEFTQLVSESEGFDKRLQKASGKQKEKIENELSARVSTLMKDGVKIYTALDPYMQNQVVAQMNSKLPYADVQGGAAVINHQTHQIIALSGGKNYQKYDFNRAYQAYRQPGSSIKPLLDYGPYIEQTGATTSSTIDASKFCSKDYCPQNYNNRTYGTVTLDTAFKNSYNTPAIR
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
43.0kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant B. subtilis pbpD expression in E.coli requires the insertion of the target DNA fragment into an E.coli expression vector, routinely a plasmid vector, and the transferral of this vector into E.coli cells. The cells are then cultured and induced to express this pbpD protein. The cells are harvested by centrifugation, samples prepared and proteins detected by polyacrylamide gel electrophoresis and subsequent staining of the gel with Coomassie Brilliant Blue or silver stain or by immunoblotting. The pbpD protein expression in E.coli is highly scalable and can be adjusted from the bacterial colony to conical flasks for liquid cultures, to fermentation reaction chambers.

Penicillin-binding protein 4 (pbpD, PBP4) can promote antibiotic resistance independently of PBP2a. Altered expression of PBP4 is at least partially responsible for the VISA phenotype. PBP4 activity and regulation appear to be important for the response of S. aureus to vancomycin. PBP4 is associated with low levels of resistance to β-lactam antibiotics, but the mechanism for this is unclear. PBP4 plays a role in cell wall biosynthesis along with multiple PBPs. Overexpression of PBP4 is associated with low levels of methicillin resistance.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Cell wall formation. Synthesis of cross-linked peptidoglycan from the lipid intermediates. The enzyme has a penicillin-insensitive transglycosylase N-terminal domain (formation of linear glycan strands) and a penicillin-sensitive transpeptidase C-terminal domain (cross-linking of the peptide subunits) (Probable). Has a partially redundant function with PBP-2A (pbpA) during spore outgrowth.
Subcellular Location
Cell membrane; Peripheral membrane protein.
Protein Families
Glycosyltransferase 51 family; Transpeptidase family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*