Purity
Greater than 90% as determined by SDS-PAGE.
Alternative Names
pbpD; BSU31490; Penicillin-binding protein 4; PBP 4) [Includes: Penicillin-insensitive transglycosylase; EC 2.4.1.129; Peptidoglycan TGase); Penicillin-sensitive transpeptidase; EC 3.4.16.4; DD-transpeptidase)]
Species
Bacillus subtilis (strain 168)
Expression Region
213-450aa
Target Protein Sequence
PNNPTLYDPLKHFDYTKSRQERLLKGLKDAGVITDKELKKAVKQKIKLDVEKREDKYPDYVSYVNDEFTQLVSESEGFDKRLQKASGKQKEKIENELSARVSTLMKDGVKIYTALDPYMQNQVVAQMNSKLPYADVQGGAAVINHQTHQIIALSGGKNYQKYDFNRAYQAYRQPGSSIKPLLDYGPYIEQTGATTSSTIDASKFCSKDYCPQNYNNRTYGTVTLDTAFKNSYNTPAIR
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
Tris-based buffer,50% glycerol
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
Recombinant B. subtilis pbpD expression in E.coli requires the insertion of the target DNA fragment into an E.coli expression vector, routinely a plasmid vector, and the transferral of this vector into E.coli cells. The cells are then cultured and induced to express this pbpD protein. The cells are harvested by centrifugation, samples prepared and proteins detected by polyacrylamide gel electrophoresis and subsequent staining of the gel with Coomassie Brilliant Blue or silver stain or by immunoblotting. The pbpD protein expression in E.coli is highly scalable and can be adjusted from the bacterial colony to conical flasks for liquid cultures, to fermentation reaction chambers.
Penicillin-binding protein 4 (pbpD, PBP4) can promote antibiotic resistance independently of PBP2a. Altered expression of PBP4 is at least partially responsible for the VISA phenotype. PBP4 activity and regulation appear to be important for the response of S. aureus to vancomycin. PBP4 is associated with low levels of resistance to β-lactam antibiotics, but the mechanism for this is unclear. PBP4 plays a role in cell wall biosynthesis along with multiple PBPs. Overexpression of PBP4 is associated with low levels of methicillin resistance.
