Recombinant Bacillus subtilis Endoglucanase (eglS)

In Stock
Code CSB-EP319201BRJ
Abbreviation Recombinant Bacillus subtilis eglS protein
MSDS
Size $388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 85% as determined by SDS-PAGE.
Target Names
eglS
Uniprot No.
Research Area
Others
Alternative Names
Carboxymethyl-cellulase;CMCase;Cellulase;Endo-1,4-beta-glucanase
Species
Bacillus subtilis (strain 168)
Source
E.coli
Expression Region
30-499aa
Target Protein Sequence
AGTKTPVAKNGQLSIKGTQLVNRDGKAVQLKGISSHGLQWYGEYVNKDSLKWLRDDWGITVFRAAMYTADGGYIDNPSVKNKVKEAVEAAKELGIYVIIDWHILNDGNPNQNKEKAKEFFKEMSSLYGNTPNVIYEIANEPNGDVNWKRDIKPYAEEVISVIRKNDPDNIIIVGTGTWSQDVNDAADDQLKDANVMYALHFYAGTHGQFLRDKANYALSKGAPIFVTEWGTSDASGNGGVFLDQSREWLKYLDSKTISWVNWNLSDKQESSSALKPGASKTGGWRLSDLSASGTFVRENILGTKDSTKDIPETPSKDKPTQENGISVQYRAGDGSMNSNQIRPQLQIKNNGNTTVDLKDVTARYWYKAKNKGQNFDCDYAQIGCGNVTHKFVTLHKPKQGADTYLELGFKNGTLAPGASTGNIQLRLHNDDWSNYAQSGDYSFFKSNTFKTTKKITLYDQGKLIWGTEPN
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
59.7 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged and C-terminal V5-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Bacillus subtilis Endoglucanase (eglS) gets expressed in E. coli and includes the complete mature protein sequence, spanning amino acids 30 to 499. The protein carries both an N-terminal 10xHis-tag and a C-terminal V5-tag, which makes purification and detection more straightforward. SDS-PAGE analysis shows it achieves greater than 85% purity, which appears to provide dependable performance for research work.

Endoglucanase from Bacillus subtilis breaks down cellulose by cutting through complex carbohydrates to produce simpler sugars. This enzyme seems central to several biological processes, particularly those related to biomass conversion and energy production. Studying it may help push forward industrial biotechnology research while deepening our grasp of how microbes degrade cellulose.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Bacillus subtilis Endoglucanase (eglS) is a bacterial enzyme that requires precise folding, proper active site formation, and specific tertiary structure for its functional activity in cellulose degradation. The E. coli expression system is homologous to this bacterial protein, which increases the probability of correct folding. The dual N-terminal 10xHis-tag and C-terminal V5-tag are relatively small (∼1 kDa and ∼1.4 kDa, respectively) compared to the protein size (470 aa, ∼50 kDa), minimizing steric interference. While the full-length mature protein (30-499aa) contains all functional domains, the probability of correct folding with functional enzymatic activity requires experimental validation of endoglucanase activity.

1. Enzyme Kinetics and Biochemical Characterization Studies

This application carries a significant risk without functional validation. Endoglucanase activity requires precise active site formation and proper folding. If correctly folded and active (verified through enzymatic assays with cellulose substrates), the protein is suitable for kinetic studies (Km, Vmax). If misfolded/inactive (unverified), kinetic measurements will yield biologically meaningless results.

2. Protein-Protein Interaction Studies

This application requires proper folding validation. Endoglucanase interactions with partners require native conformation. If correctly folded (verified), the protein may identify physiological interaction partners; if misfolded/unverified, there is a risk of non-specific binding or tag-mediated artefacts.

3. Antibody Development and Immunoassay Applications

This application is highly suitable as antibody development relies on antigenic sequence recognition rather than functional enzymatic activity. The full-length mature protein provides comprehensive epitope coverage for generating eglS-specific antibodies. The high purity (>85%) ensures minimal contamination-related issues during immunization.

4. Structural Biology and Protein Folding Studies

These studies are essential for determining folding status. Techniques should include circular dichroism spectroscopy to assess secondary structure, size-exclusion chromatography to evaluate oligomeric state, and enzymatic assays to validate functionality. If correctly folded, results are valuable; if misfolded, they characterize the recombinant construct.

Final Recommendation & Action Plan

The E. coli-expressed eglS with small dual tags has a high probability of correct folding due to the homologous expression system, but experimental validation of enzymatic activity is crucial. Begin with Application 4 (Structural Biology and Protein Folding Studies) to assess folding quality through CD spectroscopy, SEC, and validate endoglucanase activity using standard cellulose degradation assays (e.g., with carboxymethyl cellulose or other substrates). Applications 1 and 2 require rigorous functional validation before proceeding. Application 3 (antibody development) can proceed immediately. For reliable eglS research, confirm specific activity and kinetic parameters before functional applications, and consider using refolding protocols if initial validation indicates poor functionality.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*