Recombinant Bacteriophage H30 Shiga-like toxin 1 subunit B (stxB)

In Stock
Code CSB-BP303961BDK
Abbreviation Recombinant Bacteriophage H30 stxB protein
MSDS
Size $352
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 95% as determined by SDS-PAGE.
Activity
Not Test
Target Names
stxB
Uniprot No.
Research Area
Others
Species
Bacteriophage H30
Source
Baculovirus
Expression Region
21-89aa
Target Protein Sequence
TPDCVTGKVEYTKYNDDDTFTVKVGDKELFTNRWNLQSLLLSAQITGMTVTIKTNACHNGGGFSEVIFR
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
8.5 kDa
Protein Length
Full Length of Mature Protein
Tag Info
C-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Bacteriophage H30 Shiga-like toxin 1 subunit B (stxB) is produced through the baculovirus expression system, spanning amino acids 21 to 89. This full-length mature protein carries a C-terminal 6xHis tag, which makes purification and detection more straightforward. The product achieves greater than 95% purity based on SDS-PAGE analysis, suggesting it may deliver reliable results in research settings.

The Shiga-like toxin 1 subunit B (stxB) appears to be central to how the Shiga-like toxin complex functions. It enables the toxin to bind to host cell receptors—a critical step in the toxin's mechanism of action. Research on this protein could shed light on host-pathogen interactions and proves valuable for understanding microbial pathogenesis.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

The Baculovirus system provides a eukaryotic environment that supports proper folding, disulfide bond formation, and some post-translational modifications, which is advantageous for toxin proteins like stxB that require precise folding for receptor binding. stxB naturally forms a pentamer that binds to globotriaosylceramide (Gb3) receptors on host cells. The C-terminal His tag is unlikely to significantly interfere with the functional domain. While the expression system suggests a high probability of correct folding, the protein's bioactivity (specifically, its ability to form pentamers and bind Gb3) remains unknown without experimental validation.

1. Protein-Protein Interaction Studies Using Pull-Down Assays

The His tag enables pull-down assays to identify potential binding partners, particularly Gb3 or other host cell receptors. However, if stxB is misfolded or fails to form proper pentamers, interactions may be non-physiological. Validate any identified interactions using native Shiga toxin or confirm pentamer formation via size-exclusion chromatography before functional studies.

2. Antibody Development and Characterization

This application is highly suitable. The recombinant stxB can serve as an excellent immunogen for generating specific antibodies. The Baculovirus expression system likely preserves native conformational epitopes important for toxin neutralization. Validate antibodies against native Shiga toxin to ensure recognition of physiological forms.

3. Biochemical Characterization and Stability Studies

This recombinant Bacteriophage H30 stxB is well-suited for biophysical analysis of stxB properties. The high purity allows accurate assessment of oligomerization state (pentamer formation), thermal stability, and structural integrity. The Baculovirus system may produce glycosylation patterns similar to the native toxin. However, confirm pentamer formation before extrapolating data to native toxin behavior.

4. Comparative Structural and Functional Analysis

This application requires validated bioactivity. If stxB is confirmed to form functional pentamers with Gb3-binding capability, it can be used for comparative studies with other Shiga-like toxins. Without activity validation, structural comparisons may not reflect functional differences. First, verify receptor binding affinity and specificity.

Final Recommendation & Action Plan

Before using this recombinant stxB for functional applications, validate its folding and bioactivity. First, analyze its oligomeric state using size-exclusion chromatography with multi-angle light scattering (SEC-MALS) to confirm pentamer formation. Then, perform receptor binding assays using Gb3-coated surfaces or cell-based assays to verify biological activity. If active, proceed with interaction, structural, or comparative studies; if inactive, limit use to antibody production or biochemical characterization. For reliable results, always include appropriate controls with native Shiga toxin when possible.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
The B subunit is responsible for the binding of the holotoxin to specific receptors on the target cell surface, such as globotriaosylceramide (Gb3) in human intestinal microvilli.
Subcellular Location
Secreted.
Protein Families
StxB family
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*