Recombinant Bacteroides fragilis Fragilysin (btfP)

In Stock Promotion
Code CSB-EP346537BDP
Abbreviation Recombinant Bacteroides fragilis btfP protein
MSDS
Size $9.9
Promotion
CUSABIO Blowout: 4,100+ In-Stock Proteins
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP346537BDP could indicate that this peptide derived from E.coli-expressed Bacteroides fragilis btfP.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP346537BDP could indicate that this peptide derived from E.coli-expressed Bacteroides fragilis btfP.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
btfP
Uniprot No.
Research Area
Others
Alternative Names
btfPFragilysin; EC 3.4.24.74; Enterotoxin
Species
Bacteroides fragilis
Source
E.coli
Expression Region
26-405aa
Target Protein Sequence
ACSNEADSLTTSIDAPVTASIDLQSVSYTDLATQLNDVSDFGKMIILKDNGFNRQVHVSMDKRTKIQLDNENVRLFNGRDKDSTSFILGDEFAVLRFYRNGESISYIAYKEAQMMNEIAEFYAAPFKKTRAINEKEAFECIYDSRTRSAGKDIVSVKINIDKAKKILNLPECDYINDYIKTPQVPHGITESQTRAVPSEPKTVYVICLRENGSTIYPNEVSAQMQDAANSVYAVHGLKRYVNFHFVLYTTEYSCPSGDAKEGLEGFTASLKSNPKAEGYDDQIYFLIRWGTWDNKILGMSWFNSYNVNTASDFEASGMSTTQLMYPGVMAHELGHILGAEHTDNSKDLMYATFTGYLSHLSEKNMDIIAKNLGWEAADGD
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
58.6kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Bacteroides fragilis Fragilysin (btfP) is expressed in E. coli and includes an N-terminal 6xHis-SUMO tag that helps with purification and appears to improve stability. The protein covers the complete mature form, from amino acids 26 to 405. SDS-PAGE analysis shows it reaches purity levels above 90%. This product is intended for research use only and seems to offer consistent quality for experimental work.

Fragilysin is a metalloprotease that Bacteroides fragilis produces—a bacterium that's quite common in the human gut. This protein breaks down extracellular matrix components, which likely helps the bacteria establish themselves and may contribute to disease processes. The enzymatic activity of fragilysin has become a key focus for researchers studying microbial interactions and its potential role in gastrointestinal diseases, making it an important target for scientific investigation.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Based on the provided information, the recombinant Bacteroides fragilis Fragilysin is expressed in E. coli. Fragilysin is a zinc-metalloprotease toxin that requires precise folding and likely disulfide bond formation for its structural stability and activity. While E. coli can express bacterial proteins, fragilysin's functional conformation depends on correct propeptide processing and zinc coordination, which may not occur properly in E. coli without specific optimization. The N-terminal 6xHis-SUMO tag may improve solubility, but doesn't guarantee native folding. Since activity is unverified, the protein may be misfolded or inactive. The expression of the mature protein region (26-405aa) is favorable, but without functional validation, correct folding cannot be assumed.

1. Protein-Protein Interaction Studies Using Pull-Down Assays

The N-terminal 6xHis-SUMO tag facilitates purification and immobilization for pull-down experiments. However, if fragilysin is misfolded, it may not interact authentically with biological partners, potentially identifying non-physiological interactions. The SUMO tag's stability benefits are offset by the risk of misfolding. This application should only be pursued after confirming the protein's native conformation, as results from an incorrectly folded toxin would be misleading for understanding its molecular mechanisms.

2. Antibody Development and Immunoassay Applications

This application is generally suitable. The recombinant fragilysin can serve as an effective immunogen for antibody production, as antibodies often recognize linear epitopes that are less dependent on native folding. The high purity (>90%) and full-length mature protein sequence make it appropriate for generating antibodies useful in techniques like Western blotting or ELISA. However, antibodies against a potentially misfolded protein might not recognize the native, functionally active fragilysin in bacterial cultures, so validation against the native protein is recommended.

3. Biochemical Characterization and Stability Studies

This application is highly appropriate and should be prioritized. Techniques like size exclusion chromatography, dynamic light scattering can directly assess the protein's oligomeric state, folding quality, and stability. These studies are essential to determine whether the recombinant protein is properly folded before proceeding to functional assays. The high purity supports reliable characterization. Even if the protein is misfolded, these analyses provide valuable data about the recombinant product's properties.

4. Tag Removal and Functional Domain Analysis

This application is theoretically sound but depends on correct folding after tag cleavage. SUMO protease cleavage can yield untagged fragilysin, but if the protein is misfolded before cleavage, removal of the SUMO tag won't restore function. Comparing tagged versus untagged versions is valid for assessing tag interference, but this comparison is only meaningful if the core protein is properly folded. Functional assays must be performed post-cleavage to confirm activity. The approach is correct, but its success hinges on initial folding quality.

Final Recommendation & Action Plan

Given the uncertainty in folding and bioactivity, the recommended approach is to first conduct comprehensive biochemical characterization (Application #3) to assess the protein's conformational state, followed by tag cleavage and functional validation (Application #4). Priority should be given to testing proteolytic activity using known substrates (e.g., casein or specific peptide substrates) to confirm bioactivity. If the protein demonstrates expected enzymatic function, it can be cautiously used for interaction studies (Application #1), with verification of findings through complementary methods. For antibody development (Application #2), the protein can be used immediately, with the understanding that resulting antibodies may require validation against native fragilysin. Always include appropriate controls and consider the potential need for refolding optimization if initial characterization reveals misfolding.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

 Q&A
Q:

I saw that the your company has Fragilysin recombinant protein and cytolethal distending toxin (CDT) produced from E.coli and mammalian cell.
Regarding the fragilysin recombinant protein,
1. May I know if there is any difference in activity between Fragilysin recombinant protein from E.coli vs mammalian cell?
Will the recombinant protein produced from mammalian cells be more active/ genotoxic?
As we are interested in studying the effect of the fragilysin on human tumor cells, but we are not sure if it is good to use the fragilysin recombinant protein from E.coli or mammalian cell.
2. Could you give more information on the measurement of activity of fragilysin?
3. Does any publication use the fragilis recombinant protein from Cusabio before?
4. Is there endotoxin test conducted on these fragilis recombinant protein? Are they low in endotoxin?
5. May I know what other recombinant protein that i can use as a negative control?

A:
Thanks for your inquiry.
1. This protein is Bacteroides fragilis, protein from E.coli expression system maybe more suitable.
2. Regarding activity, we didn't test activity of this protein, cannot 100% guaranteed. But what we provide is the full length of mature protein, which is purified under mild condition, it is active in theory.
3、Currently, there is no publication of this product.
4、We could provide endotoxin removal service, and the protein will be low in endotoxin.
5、Could you please tell what experiment you will use this protein for? What kind of negtive control you need?
Q:

I want to clarify some details:
· Are the samples all derived from E. coli?
· Are the proteins supplied in powder form?

A:
Thanks for your inquiry. Our response is as below. · Are the samples all derived from E. coli?
Yes, they are.
· Are the proteins supplied in powder form?
The proteins will be supplied in liquid form.
The protein concentration is 0.3 mg/ml. The storage buffer is 0.2 μm sterile filtered 20 mM Tris-HCl,0.5M NaCl,pH 8.0,20% glycerin.
Q:

Regarding the fragilysin recombinant protein,
1. May I know if there is any difference in activity between Fragilysin recombinant protein from E.coli vs mammalian cell?
Will the recombinant protein produced from mammalian cells be more active/ genotoxic?
As we are interested in studying the effect of the fragilysin on human tumor cells, but we are not sure if it is good to use the fragilysin recombinant protein from E.coli or mammalian cell.
2. Could you give more information on the measurement of activity of fragilysin?
3. Does any publication use the fragilis recombinant protein from Cusabio before?
4. Is there endotoxin test conducted on these fragilis recombinant protein? Are they low in endotoxin?
5. May I know what other recombinant protein that i can use as a negative control?

A:
Thanks for your inquiry.
1. This protein is Bacteroides fragilis, protein from E.coli expression system maybe more suitable.
2. Regarding activity, we didn't test activity of this protein, cannot 100% guaranteed. But what we provide is the full length of mature protein, which is purified under mild condition, it is active in theory.
3. Currently, there is no publication of this product.
4. We could provide endotoxin removal service, and the protein will be low in endotoxin.
5. Could you please tell what experiment you will use this protein for? What kind of negtive control you need?
Q:

We're interested in purchasing 100 mg of your item CSB-EP346537BDP. Can you inform me whether these proteins are in any way inactivated, and, if not, a recommended method for inactivation that will preserve their antigenicity when used to promote target-specific antibody production, specifically in birds (chickens).

A:
Very nice to receive your inquiry.
1. The current lot of this protein is expressed in the supernatant. Another customer had feedback on the biological activity of this protein as follows: The BFT is active which cleaves the E-cadherin and causes the rouding of HT29 cells after 1hr of treatment.
2. If you plan to use the protein for immunization, we can provide inactive protein. We will optimize the conditions for inclusion body expression and then use a denaturant-containing solvent to solubilize the protein, such as guanidine hydrochloride, urea, SKL, etc.
Please confirm which denaturant you prefer and the final concentration of the denaturant (for example, the final concentration of the denaturant should be lower than XX) to meet the need of your immunization. Inclusion body expression + Adding denaturant→ The protein should be inactive and the primary structure is still immunogenic.
Q:

Do you have any suggestions for which denaturant to choose and the final concentration?

A:
Thanks for your response. For the three denaturants mentioned in the previous email, guanidine hydrochloride 6M, urea 8M, SKL 0.5% is our common additive concentration.
We have used these three denaturants for immunization before, but they were all diluted 4-8 times before they were used in immunization. Among them, the effect of urea 8M after dilution was best.
The protein concentration of the inclusion body is generally higher. We could deliver this protein with higher concentration based on the concentration requirement of your immunization experiment, so you could dilute the protein based on your demand. If you have specified protein concentration, please tell us.

Target Background

Function
Diarrheal toxin that hydrolyzes gelatin, azocoll, actin, tropomyosin, and fibrinogen.
Subcellular Location
Secreted.
Protein Families
Peptidase M10C family
Database Links

KEGG: ag:AAB49835

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*