Recombinant Bacteroides fragilis Fragilysin (btfP)

In Stock
Code CSB-EP346537BDP
Size US$388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP346537BDP could indicate that this peptide derived from E.coli-expressed Bacteroides fragilis btfP.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP346537BDP could indicate that this peptide derived from E.coli-expressed Bacteroides fragilis btfP.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
btfP
Uniprot No.
Research Area
Others
Alternative Names
btfPFragilysin; EC 3.4.24.74; Enterotoxin
Species
Bacteroides fragilis
Source
E.coli
Expression Region
26-405aa
Target Protein Sequence
ACSNEADSLTTSIDAPVTASIDLQSVSYTDLATQLNDVSDFGKMIILKDNGFNRQVHVSMDKRTKIQLDNENVRLFNGRDKDSTSFILGDEFAVLRFYRNGESISYIAYKEAQMMNEIAEFYAAPFKKTRAINEKEAFECIYDSRTRSAGKDIVSVKINIDKAKKILNLPECDYINDYIKTPQVPHGITESQTRAVPSEPKTVYVICLRENGSTIYPNEVSAQMQDAANSVYAVHGLKRYVNFHFVLYTTEYSCPSGDAKEGLEGFTASLKSNPKAEGYDDQIYFLIRWGTWDNKILGMSWFNSYNVNTASDFEASGMSTTQLMYPGVMAHELGHILGAEHTDNSKDLMYATFTGYLSHLSEKNMDIIAKNLGWEAADGD
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight
58.6kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

 Q&A
Q:

I saw that the your company has Fragilysin recombinant protein and cytolethal distending toxin (CDT) produced from E.coli and mammalian cell.
Regarding the fragilysin recombinant protein,
1. May I know if there is any difference in activity between Fragilysin recombinant protein from E.coli vs mammalian cell?
Will the recombinant protein produced from mammalian cells be more active/ genotoxic?
As we are interested in studying the effect of the fragilysin on human tumor cells, but we are not sure if it is good to use the fragilysin recombinant protein from E.coli or mammalian cell.
2. Could you give more information on the measurement of activity of fragilysin?
3. Does any publication use the fragilis recombinant protein from Cusabio before?
4. Is there endotoxin test conducted on these fragilis recombinant protein? Are they low in endotoxin?
5. May I know what other recombinant protein that i can use as a negative control?

A:
Thanks for your inquiry.
1. This protein is Bacteroides fragilis, protein from E.coli expression system maybe more suitable.
2. Regarding activity, we didn't test activity of this protein, cannot 100% guaranteed. But what we provide is the full length of mature protein, which is purified under mild condition, it is active in theory.
3、Currently, there is no publication of this product.
4、We could provide endotoxin removal service, and the protein will be low in endotoxin.
5、Could you please tell what experiment you will use this protein for? What kind of negtive control you need?
Q:

I want to clarify some details:
· Are the samples all derived from E. coli?
· Are the proteins supplied in powder form?

A:
Thanks for your inquiry. Our response is as below. · Are the samples all derived from E. coli?
Yes, they are.
· Are the proteins supplied in powder form?
The proteins will be supplied in liquid form.
The protein concentration is 0.3 mg/ml. The storage buffer is 0.2 μm sterile filtered 20 mM Tris-HCl,0.5M NaCl,pH 8.0,20% glycerin.
Q:

Regarding the fragilysin recombinant protein,
1. May I know if there is any difference in activity between Fragilysin recombinant protein from E.coli vs mammalian cell?
Will the recombinant protein produced from mammalian cells be more active/ genotoxic?
As we are interested in studying the effect of the fragilysin on human tumor cells, but we are not sure if it is good to use the fragilysin recombinant protein from E.coli or mammalian cell.
2. Could you give more information on the measurement of activity of fragilysin?
3. Does any publication use the fragilis recombinant protein from Cusabio before?
4. Is there endotoxin test conducted on these fragilis recombinant protein? Are they low in endotoxin?
5. May I know what other recombinant protein that i can use as a negative control?

A:
Thanks for your inquiry.
1. This protein is Bacteroides fragilis, protein from E.coli expression system maybe more suitable.
2. Regarding activity, we didn't test activity of this protein, cannot 100% guaranteed. But what we provide is the full length of mature protein, which is purified under mild condition, it is active in theory.
3. Currently, there is no publication of this product.
4. We could provide endotoxin removal service, and the protein will be low in endotoxin.
5. Could you please tell what experiment you will use this protein for? What kind of negtive control you need?
Q:

We're interested in purchasing 100 mg of your item CSB-EP346537BDP. Can you inform me whether these proteins are in any way inactivated, and, if not, a recommended method for inactivation that will preserve their antigenicity when used to promote target-specific antibody production, specifically in birds (chickens).

A:
Very nice to receive your inquiry.
1. The current lot of this protein is expressed in the supernatant. Another customer had feedback on the biological activity of this protein as follows: The BFT is active which cleaves the E-cadherin and causes the rouding of HT29 cells after 1hr of treatment.
2. If you plan to use the protein for immunization, we can provide inactive protein. We will optimize the conditions for inclusion body expression and then use a denaturant-containing solvent to solubilize the protein, such as guanidine hydrochloride, urea, SKL, etc.
Please confirm which denaturant you prefer and the final concentration of the denaturant (for example, the final concentration of the denaturant should be lower than XX) to meet the need of your immunization. Inclusion body expression + Adding denaturant→ The protein should be inactive and the primary structure is still immunogenic.
Q:

Do you have any suggestions for which denaturant to choose and the final concentration?

A:
Thanks for your response. For the three denaturants mentioned in the previous email, guanidine hydrochloride 6M, urea 8M, SKL 0.5% is our common additive concentration.
We have used these three denaturants for immunization before, but they were all diluted 4-8 times before they were used in immunization. Among them, the effect of urea 8M after dilution was best.
The protein concentration of the inclusion body is generally higher. We could deliver this protein with higher concentration based on the concentration requirement of your immunization experiment, so you could dilute the protein based on your demand. If you have specified protein concentration, please tell us.

Target Background

Function
Diarrheal toxin that hydrolyzes gelatin, azocoll, actin, tropomyosin, and fibrinogen.
Subcellular Location
Secreted.
Protein Families
Peptidase M10C family
Database Links

KEGG: ag:AAB49835

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 322 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join Us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2023 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*