Recombinant Bordetella bronchiseptica Azurin (BB3856)

In Stock
Code CSB-YP358313BTYa4
Abbreviation Recombinant Bordetella bronchiseptica Azurin protein
MSDS
Size $436
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
BB3856
Uniprot No.
Research Area
Others
Alternative Names
BB3856Azurin
Species
Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) (Alcaligenes bronchisepticus)
Source
Yeast
Expression Region
22-150aa
Target Protein Sequence
AECSVDIAGTDQMQFDKKAIEVSKSCKQFTVNLKHTGKLPRNVMGHNWVLTKTADMQAVEKDGIAAGLDNQYLKAGDTRVLAHTKVLGGGESDSVTFDVAKLAAGDDYTFFCSFPGHGALMKGTLKLVD
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
29.8 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-sumostar-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Bordetella bronchiseptica Azurin (BB3856) is produced using a yeast expression system and contains the complete mature protein spanning amino acids 22 to 150. The protein includes an N-terminal 6xHis-sumostar tag, which aids in purification and detection processes. SDS-PAGE analysis confirms that the product achieves greater than 90% purity. This level of purity appears to support reliable performance in research work, while endotoxin levels remain appropriate for experimental applications.

Azurin from Bordetella bronchiseptica serves an important function in electron transfer processes. This small, blue copper protein participates in various biological oxidation-reduction reactions. Its capacity to mediate electron transfer has drawn attention from researchers studying bacterial respiratory pathways and bioenergetics. The protein's distinctive characteristics continue to make it valuable for biochemical and biophysical investigations.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Based on the provided information, the recombinant azurin protein is unlikely to be correctly folded or fully bioactive for its native functions. Azurin is a type I copper protein requiring precise coordination of a copper ion within its beta-barrel structure for proper folding and electron transfer function. The N-terminal 6xHis-SUMOstar tag (approximately 15-20 kDa) is substantially larger than the mature azurin domain (∼14 kDa) and may severely interfere with the protein's tertiary structure, particularly near the copper-binding site which is essential for function. While the yeast expression system provides eukaryotic folding machinery, the massive fusion tag likely prevents proper copper incorporation and structural maturation. 

This recombinant azurin can generate antibodies, but they will primarily recognize the immunodominant SUMOstar tag rather than azurin-specific epitopes. For antibodies targeting native azurin conformations, the fusion tag must be removed before immunization. The current construct is more suitable for developing anti-SUMOstar tag antibodies. In immunoassays, the signal will predominantly come from tag recognition rather than azurin detection.

Given the substantial interference from the large SUMOstar tag, the primary recommendation is to remove the fusion tag using the SUMO protease recognition site (inherent in SUMOstar systems) and purify the tag-free azurin before any functional studies. The purification strategy should include affinity chromatography using the His-tag (on the SUMOstar portion), SUMO protease cleavage, followed by reverse purification to separate the tag-free azurin from the cleaved tag and protease. After tag removal, the protein should be characterized by UV-visible spectroscopy to confirm copper incorporation (A625 nm), circular dichroism to verify proper beta-barrel folding, and functional assays to validate electron transfer capability. Until tag removal and functional validation are completed, applications should be limited to tag-characterization studies rather than native azurin functions.

 

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Subcellular Location
Periplasm.
Database Links

KEGG: bbr:BB3856

STRING: 257310.BB3856

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*