Recombinant Bovine Odorant-binding protein

In Stock
Code CSB-EP362133BO
Abbreviation Recombinant Bovine Odorant-binding protein
MSDS
Size $554
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 85% as determined by SDS-PAGE.
Target Names
N/A
Uniprot No.
Research Area
Others
Alternative Names
Odorant-binding protein; OBP; Olfactory mucosa pyrazine-binding protein
Species
Bos taurus (Bovine)
Source
E.coli
Expression Region
1-159aa
Target Protein Sequence
AQEEEAEQNLSELSGPWRTVYIGSTNPEKIQENGPFRTYFRELVFDDEKGTVDFYFSVKRDGKWKNVHVKATKQDDGTYVADYEGQNVFKIVSLSRTHLVAHNINVDKHGQTTELTELFVKLNVEDEDLEKFWKLTEDKGIDKKNVVNFLENEDHPHPE
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
22.3 kDa
Protein Length
Full Length
Tag Info
N-terminal S-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Tris-based buffer,50% glycerol
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Bovine Odorant-binding protein is produced in E. coli, covering the full-length amino acid sequence from 1 to 159. This product is tag-free and achieves a purity level of over 85%, as verified by SDS-PAGE analysis. It's designed for research use with a focus on accuracy and reliability, ensuring minimal endotoxin interference to suit various scientific applications.

Odorant-binding proteins appear to be integral to the olfactory system, carrying odor molecules to receptors. In bovines, these proteins may play a crucial role in detecting and binding odorants, which is essential for understanding olfactory signaling pathways and the mechanisms of scent detection. This recombinant protein serves as a valuable tool for research into sensory biology and protein-ligand interactions.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Bovine odorant-binding protein (OBP) is a small soluble protein that typically requires proper folding to form a hydrophobic binding pocket for odorants. The E. coli expression system can often produce soluble versions of such proteins, but the presence of an N-terminal S-tag (a 15-amino acid tag) may slightly affect the protein's N-terminal structure or stability. However, since OBP is not a complex multidomain protein and the tag is small, the protein has a moderate to high likelihood of being correctly folded. Its activity (odorant binding) should be experimentally verified but is feasible.

1. Protein-Protein Interaction Studies

Functional binding studies depend on native conformation. The small S-tag may not severely hinder interactions, but activity must be verified before reliable use. If the protein is correctly folded, it could be used to study interactions with odorants or other proteins (e.g., receptors) via SPR or BLI. However, the S-tag might sterically interfere with some interactions, and the protein's binding activity must be confirmed first. Negative results could arise from misfolding or tag interference.

2. Biochemical Characterization and Stability Studies

This is a priority application to assess the protein's folding and stability. Techniques like DSF, DLS, and circular dichroism can determine thermal stability, oligomeric state, and secondary structure. The S-tag is small and unlikely to significantly alter biophysical properties, making this application highly reliable for characterizing the protein's intrinsic properties. These studies are essential for quality control and can be performed regardless of functional activity, providing data on folding and stability.

3. Antibody Development and Validation

This recombinant OBP is highly suitable as an immunogen for antibody production. The full-length sequence ensures broad epitope coverage, and the S-tag may even provide an additional epitope for screening. Antibodies can be validated using Western blot, ELISA, or immunohistochemistry, with the protein serving as a positive control.

4. Comparative Structural and Functional Analysis

This protein can be used for comparative studies with OBPs from other species, focusing on structural features (e.g., via circular dichroism) or sequence conservation. However, functional comparisons (e.g., odorant binding affinity) require prior validation of this protein's activity. The S-tag may slightly affect structural comparisons but not significantly.

Final Recommendation & Action Plan

This recombinant OBP is likely to be correctly folded due to its simple structure and small tag, but functional activity must be confirmed before use in binding or comparative functional studies. The immediate priority is Application 2 (Biochemical Characterization) to verify folding and stability via DSF, DLS, or circular dichroism. If the protein shows native-like structure, proceed to validate odorant-binding activity using a known ligand (e.g., fluorescent odorant binding assay). Once activity is confirmed, Applications 1 and 4 (interaction studies and functional comparisons) can be pursued. Application 3 (Antibody Development) can proceed immediately regardless of functional status. If activity is low, focus on structural and immunological applications only. This stepwise approach ensures reliable outcomes.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
This protein binds a wide variety of chemical odorants.
Subcellular Location
Secreted.
Protein Families
Calycin superfamily, Lipocalin family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*