Recombinant Brugia malayi tRNA (guanine-N (7)-)-methyltransferase (Bm1_01445)

In Stock
Code CSB-EP427056BWV
Abbreviation Recombinant Brugia malayi Bm1_01445 protein
MSDS
Size $388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
Bm1_01445
Uniprot No.
Research Area
Others
Alternative Names
tRNA (guanine(46)-N(7))-methyltransferase tRNA(m7G46)-methyltransferase
Species
Brugia malayi (Filarial nematode worm)
Source
E.coli
Expression Region
1-258aa
Target Protein Sequence
MVSTENKIGLFKNKDDDIDGEEMRELPQKKFYRQRAHANPISDHEFDYPVFPEQMDWKKYFGDFSEGRQVEFADVGCGYGGLLIKLSTLYPEALMVGLEIRVKVSDYVQDKIHALRLREPGNYRNVACLRTNAMKYLPNYFRRHQLTKMFFLYPDPHFKKAKHKWRIITPTLLAEYAYVLKPGGLVYTITDVEELHIWMVRHLSAHPLFERLTDLEMKMDPVVEMLYDSTEEGQKVARNEGSKWSAVFRRLPNPVLSS
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
36.3 kDa
Protein Length
Full Length
Tag Info
N-terminal 10xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Brugia malayi tRNA (guanine-N(7)-)-methyltransferase (Bm1_01445) is expressed in E.coli, covering amino acids 1 to 258, and is provided as a full-length protein. It features an N-terminal 10xHis-tag for ease of purification and detection. The protein is purified to a level greater than 85% as determined by SDS-PAGE, ensuring a high-quality reagent suitable for various research applications.

tRNA (guanine-N(7)-)-methyltransferase is an enzyme involved in the post-transcriptional modification of tRNA molecules. This protein catalyzes the methylation of guanine bases, a critical step in tRNA maturation that influences the stability and function of tRNA. Studying this enzyme appears important for understanding the molecular mechanisms underlying RNA modification processes, which seem essential in the regulation of gene expression.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

The recombinant Brugia malayi tRNA (guanine-N(7)-)-methyltransferase expressed in yeast with an N-terminal 10×His tag represents the full-length enzyme, which greatly increases the likelihood of correct folding. Yeast expression systems are well-suited for soluble cytosolic enzymes such as methyltransferases, which do not depend heavily on post-translational modifications for activity. Moreover, methyltransferases are typically monomeric, globular enzymes that fold autonomously. However, since enzymatic activity has not been experimentally verified, its bioactivity remains presumptive. Validation using methyltransferase activity assays (e.g., SAM-dependent methyl transfer to tRNA) is recommended to confirm catalytic function.

1. In Vitro Enzymatic Activity Characterization

This recombinant tRNA methyltransferase can be used to study enzymatic activity and substrate specificity in vitro. It is suitable for biochemical assays measuring guanine-N(7)-methylation on tRNA substrates and for determining kinetic parameters such as Km and Vmax. If the enzyme is properly folded, it should exhibit catalytic activity consistent with native methyltransferase function. If misfolded or partially inactive, it can still be used for substrate binding or cofactor association studies, but quantitative kinetic results may not be reliable. Therefore, activity validation through SAM-dependent methyltransferase assays is essential before mechanistic interpretation.

2. Comparative Enzyme Studies Between Species

The recombinant B. malayi methyltransferase serves as a strong reference for cross-species comparisons among tRNA methyltransferases. Researchers can evaluate differences in substrate range, catalytic rates, and cofactor affinity between orthologs. If correctly folded, it enables meaningful comparative enzymology reflecting evolutionary divergence. If folding is uncertain, it can still be used for sequence and structure-based comparisons, but functional data must be interpreted with caution until enzymatic competence is confirmed.

3. Antibody Development and Validation

This His-tagged full-length methyltransferase is well suited for generating specific antibodies. The >85% purity supports its use as an immunogen in antibody production and validation assays. If folded correctly, the antigen will generate antibodies that recognize both native and recombinant enzyme. If misfolded, it can still be used to produce antibodies recognizing linear epitopes for use in ELISA or Western blotting, though they may not recognize the native conformation in immunostaining or immunoprecipitation assays. Thus, the recombinant protein remains a valid immunogen for antibody production.

4. Protein-Protein Interaction Studies

This recombinant methyltransferase can be used to identify interacting proteins or cofactors through pull-down or affinity-based assays. The N-terminal 10×His tag facilitates immobilization on nickel-affinity matrices for screening nematode lysates or recombinant libraries. If the protein retains native folding, such assays can reveal biologically relevant partners involved in RNA modification pathways. If misfolded, captured interactions may be nonspecific, so secondary validation (e.g., co-expression or co-immunoprecipitation) is needed to confirm physiological relevance.

5. Structural and Biophysical Analysis

This purified recombinant enzyme provides suitable material for biophysical and structural characterization (e.g., CD spectroscopy, DLS, DSC, or crystallization trials). If properly folded, it can be used for high-resolution structural studies such as X-ray crystallography or NMR to define catalytic residues and cofactor-binding sites. If partially misfolded, it still serves for low-resolution or stability analyses, but crystallographic success or NMR quality will be limited. Verification of homogeneity and folding is thus a prerequisite for advanced structural studies.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Catalyzes the formation of N(7)-methylguanine at position 46 (m7G46) in tRNA.
Subcellular Location
Nucleus.
Protein Families
Class I-like SAM-binding methyltransferase superfamily, TrmB family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*