Recombinant Calloselasma rhodostoma Snaclec rhodocytin subunit alpha

In Stock
Code CSB-EP888242CBG
Abbreviation Recombinant Calloselasma rhodostoma Snaclec rhodocytin subunit alpha protein
MSDS
Size US$388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Uniprot No.
Research Area
Others
Alternative Names
; Snaclec rhodocytin subunit alpha; Aggretin alpha chain; Rhodoaggretin subunit alpha
Species
Calloselasma rhodostoma (Malayan pit viper) (Agkistrodon rhodostoma)
Source
E.coli
Expression Region
1-136aa
Target Protein Sequence
GLEDCDFGWSPYDQHCYQAFNEQKTWDEAEKFCRAQENGAHLASIESNGEADFVSWLISQKDELADEDYVWIGLRAQNKEQQCSSEWSDGSSVSYENLIDLHTKKCGALEKLTGFRKWVNYYCEQMHAFVCKLLPY
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
31.8kDa
Protein Length
Full Length
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The full-length cDNA ORF of Calloselasma rhodostoma Snaclec rhodocytin subunit alpha was N-terminally tagged a 6xHis-SUMO and then expressed in the E.coli cells. The recombinant Calloselasma rhodostoma Snaclec rhodocytin subunit alpha thus obtained was purified using SDS-PAGE analysis and got over 90% of purity. Under reducing conditions, this protein migrated to an approximately 28 kDa molecular mass band on the SDS-PAGE gel. This recombinant Snaclec rhodocytin subunit alpha protein may be used to produce specific antibodies or in the studies of snaclec rhodocytin-mediated signal transduction.

Snaclec rhodocytin is a disulfide‐linked heterodimeric C‐type lectin derived from Calloselasma rhodostoma and is made up of α‐subunits and β‐subunits. The interaction between snaclec rhodocytin and C‐type lectin‐like receptor 2 (CLEC-2) induces platelet aggregation. CLEC‐2 physiologically binding to podoplanin (PDPN), which is expressed on some tumor cell types, participates in tumor cell‐induced platelet aggregation and tumor metastasis. This may propose a possible source of anti‐CLEC‐2 drugs for both antiplatelet and antimetastasis therapy through rhodocytin modification.

Citations

Customer Reviews and Q&A

 Customer Reviews
Average Rating:
5.0 - 1 reviews

Submit a Review here

Applications : Platelet Aggregation Assay

Review: rhodocytin (a CLEC-2 ligand) was not affected by dasatinib ointment at both day 3 and day 13 postinjury.

By Anonymous

Target Background

Function
Elicits platelet aggregation by the binding to the C-type lectin domain family 1 member B (CLEC1B/CLEC2). Binding leads to tyrosine phosphorylation in the cytoplasmic tail of CLEC1B, which promotes the binding of spleen tyrosine kinase (Syk), subsequent activation of PLC-gamma-2, and platelet activation and aggregation. Binding to GPIbalpha (GP1BA) and alpha-2/beta-1 (ITGA2/ITGB1) may also induce aggregation, but this is controversial.
Subcellular Location
Secreted.
Protein Families
Snaclec family
Tissue Specificity
Expressed by the venom gland.
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*