Recombinant Calloselasma rhodostoma Thrombin-like enzyme ancrod

In Stock
Code CSB-YP338742CBG
MSDS
Size $436
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
N/A
Uniprot No.
Research Area
Others
Alternative Names
Thrombin-like enzyme ancrod; SVTLE; EC 3.4.21.74; Fibrinogen-clotting enzyme; Snake venom serine protease; SVSP; Venombin A
Species
Calloselasma rhodostoma (Malayan pit viper) (Agkistrodon rhodostoma)
Source
Yeast
Expression Region
1-234aa
Target Protein Sequence
VIGGDECNINEHRFLVAVYEGTNWTFICGGVLIHPEWVITAEHCARRRMNLVFGMHRKSEKFDDEQERYPKKRYFIRCNKTRTSWDEDIMLIRLNKPVNNSEHIAPLSLPSNPPIVGSDCRVMGWGSINRRIDVLSDEPRCANINLHNFTMCHGLFRKMPKKGRVLCAGDLRGRRDSCNSDSGGPLICNEELHGIVARGPNPCAQPNKPALYTSIYDYRDWVNNVIAGNATCSP
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight
28.6kDa
Protein Length
Full Length
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Tris-based buffer,50% glycerol
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The recombinant Calloselasma rhodostoma Thrombin-like enzyme ancrod (SVTLE) is a yeast-expressed (1-234aa) protein with N-terminal 6xHis tag. The purity is 90%+ measured by SDS-PAGE. The highly developed genetic system, ease of use, reduced time input, and costs have made Pichia Pastoris an attractive organism for the expression and production of recombinant proteins. So we choose the Yeast system to express this recombinant Thrombin-like enzyme ancrod (SVTLE) protein, which is able to carry specifically designed plasmids, and the plasmid used consists of restriction sites that can be used to insert the gene sequence of interest. Transformation of yeasts with the plasmid produces the desired protein and can be appropriately scaled up.

Ancrod is a thrombin-like enzyme that induces rapid defibrinogenation in humans by splitting fibrinopeptide A from fibrinogen. Ancord was developed for the treatment of ischaemic stroke and myocardial infarction as well as deep-vein thrombosis. In addition to reducing fibrinogen, ancord also lowers blood viscosity, suppresses erythrocyte aggregation, indirectly stimulates thrombolysis, and possibly leads to vasodilatation. It also possesses a weak anticoagulant activity at high dosages.

Customer Reviews and Q&A

 Customer Reviews
Average Rating:
5.0 - 1 reviews

Submit a Review here

Applications : Drug related studies

Review: Effect of various doses of recombinant SVTLEs on clotting time of normal human plasma. The minimum coagulant dose (MCD) corresponds to the least amount of enzyme that induces clotting within 60 s.

By Anonymous

Target Background

Function
Thrombin-like snake venom serine protease that acts as an anticoagulant. It cleaves fibrinogen (FGA) to split off the A-fibrinopeptides (A, AY and AP), but not the B-fibrinopeptide. The resulting fibrin polymers are imperfectly formed and much smaller in size (1 to 2 um long) than the fibrin polymers produced by the action of thrombin. These ancrod-induced microthrombi are friable, unstable, urea-soluble and have significantly degraded alpha chains. They do not cross-link to form thrombi. They are markedly susceptible to digestion by plasmin and are rapidly removed from circulation by either reticuloendothelial phagocytosis or normal fibrinolysis, or both. Anticoagulation through the removal of fibrinogen from the blood is rapid, occurring within hours following its administration. It does not activate plasminogen and does not degrade preformed, fully cross-linked thrombin fibrin. It also reduces the level of plasminogen activator inhibitor (PAI) and may stimulate the release of tissue plasminogen activator (PLAT) from the endothelium. The profibrinolytic effect of these 2 actions appears to be limited to local microthrombus degradation.
Subcellular Location
Secreted.
Protein Families
Peptidase S1 family, Snake venom subfamily
Tissue Specificity
Expressed by the venom gland.
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*