Recombinant Campylobacter fetus S-layer protein (sapA), partial

In Stock
Code CSB-EP330493CYZ
Abbreviation Recombinant Campylobacter fetus sapA protein, partial
MSDS
Size $388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
sapA
Uniprot No.
Research Area
Others
Alternative Names
Surface array protein
Species
Campylobacter fetus
Source
E.coli
Expression Region
1-268aa
Target Protein Sequence
MLNKTDVSMLYITIMGMASEGDGNKYWLDYANNNSLGVSSLANIMLDSPGAAKFFGDSLLAGNEKDFVTKIYSIALGNTSDVDGINYWTKAITGGGEFTDSKGNVISVASLSKGDLIGAMINSMVNGGSAESKAIFEAKAAASDYFADATLVRDISGLDEGTTSKLISEINSASDLDKVKSEIDALKSELPNPGSTYDLTEGNDNLKGTDLDDTFNGTTYVGNGTNKSTLSAFDKIDGGAGRDTLNAIFTANNNAAAATKLDQAEIDK
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
33.0 kDa
Protein Length
partial
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Synthesizing the recombinant Campylobacter fetus S-layer protein (sapA) generally involves integrating the DNA fragment that encodes the Campylobacter fetus sapA protein (1-268aa) into a plasmid along with the N-terminal 10xHis-tag and C-terminal Myc-tag gene, introducing the recombinant plasmid into E.coli cells, followed by the selection and culturing of positive E.coli cells, induction of protein expression, and subsequent cell lysis. The protein is purified through affinity purification, and SDS-PAGE analysis is conducted to confirm the presence of the protein and determine its purity. The protein's purity surpasses 85%.

Saposin A is a glycosphingolipid activator protein that is crucial in breaking down cerebroside sulfates within the lysosome [1]. It is derived from the proteolytic processing of domain 1 of its precursor protein, prosaposin [2]. Saposin A, along with other saposins like B, C, and D, acts at the lipid-water interface in lysosomes, facilitating the hydrolysis of membrane components by water-soluble exohydrolases [3]. Saposin A has tissue-specific effects on glycosphingolipid degradation, as observed in mutant mice studies [4]. Additionally, saposin A has been linked to neurological deficits and glycosphingolipid accumulation in cases of saposin B deficiency [5].

Saposin A is part of a family of saposins, each with distinct functions. Saposin B, for example, is involved in the activation of arylsulfatase A, β-galactosidase, α-galactosidase, and neuraminidase [6]. On the other hand, saposin C acts as an activator of the lysosomal enzyme glucocerebrosidase, which hydrolyzes glucocerebroside into glucose and cerebroside [7]. The crystal structures of saposins A and C have been elucidated, showing compact monomeric structures with small hydrophobic cores [8][9].

References:
[1] V. Ahn, K. Faull, J. Whitelegge, A. Fluharty, & G. Privé, Crystal structure of saposin b reveals a dimeric shell for lipid binding, Proceedings of the National Academy of Sciences, vol. 100, no. 1, p. 38-43, 2002. https://doi.org/10.1073/pnas.0136947100
[2] S. Morimoto, B. Martin, Y. Yamamoto, K. Kretz, J. O’Brien, & Y. Kishimoto, Saposin a: second cerebrosidase activator protein., Proceedings of the National Academy of Sciences, vol. 86, no. 9, p. 3389-3393, 1989. https://doi.org/10.1073/pnas.86.9.3389
[3] R. Schultz-Heienbrok, N. Remmel, R. Klingenstein, M. Rossocha, K. Sandhoff, & T. Maier, Crystallization and preliminary characterization of three different crystal forms of human saposin c heterologously expressed inpichia pastoris, Acta Crystallographica Section F Structural Biology and Crystallization Communications, vol. 62, no. 2, p. 117-120, 2006. https://doi.org/10.1107/s1744309105043186
[4] Y. Sun, M. Zamzow, H. Ran, W. Zhang, B. Quinn, S. Barneset al., Tissue-specific effects of saposin a and saposin b on glycosphingolipid degradation in mutant mice, Human Molecular Genetics, vol. 22, no. 12, p. 2435-2450, 2013. https://doi.org/10.1093/hmg/ddt096
[5] Y. Sun, D. Witte, H. Ran, M. Zamzow, S. Barnes, H. Chenget al., Neurological deficits and glycosphingolipid accumulation in saposin b deficient mice, Human Molecular Genetics, vol. 17, no. 15, p. 2345-2356, 2008. https://doi.org/10.1093/hmg/ddn135
[6] M. Champagne, S. Lamontagne, & M. Potier, Binding of gm1‐ganglioside to a synthetic peptide derived from the lysosomal sphingolipid‐activator‐protein saposin b, Febs Letters, vol. 347, no. 2-3, p. 265-267, 1994. https://doi.org/10.1016/0014-5793(94)00536-2
[7] E. Alba, S. Weiler, & N. Tjandra, Solution structure of human saposin c:  ph-dependent interaction with phospholipid vesicles, Biochemistry, vol. 42, no. 50, p. 14729-14740, 2003. https://doi.org/10.1021/bi0301338
[8] V. Ahn, P. Leyko, J. Alattia, L. Chen, & G. Privé, Crystal structures of saposins a and c, Protein Science, vol. 15, no. 8, p. 1849-1857, 2006. https://doi.org/10.1110/ps.062256606
[9] K. Popovic and G. Privé, Structures of the human ceramide activator protein saposin d, Acta Crystallographica Section D Biological Crystallography, vol. 64, no. 5, p. 589-594, 2008. https://doi.org/10.1107/s0907444908003120

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
The S-layer is a paracrystalline mono-layered assembly of proteins which coats the surface of bacteria. This protein is critical for virulence.
Subcellular Location
Secreted, cell wall, S-layer. Note=This bacterium is covered by a S-layer with hexagonal symmetry.
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*