Recombinant Chicken Midkine (RIHB)

In Stock
Code CSB-EP013624CH
Abbreviation Recombinant Chicken RIHB protein
MSDS
Size US$388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
RIHB
Uniprot No.
Research Area
Others
Alternative Names
RIHB; Midkine; Retinoic acid-induced heparin-binding protein; RI-HB
Species
Gallus gallus (Chicken)
Source
E.coli
Expression Region
22-142aa
Target Protein Sequence
AKAKKEKMKKEGSECQDWHWGPCIPNSKDCGLGYREGSCGDESRKLKCKIPCNWKKKFGADCKYKFESWGGCSAKTGVKTRSGILKKALYNAECEEVVYVSKPCTAKMKAKAKAKKGKGKD
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
20.9 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Chicken Midkine (RIHB) is produced in E. coli and contains the full-length mature protein spanning amino acids 22 to 142. The protein comes engineered with both an N-terminal 10xHis tag and a C-terminal Myc tag for streamlined purification and detection. SDS-PAGE analysis shows the protein maintains greater than 85% purity, which appears adequate for most research applications. This product is intended for research use only.

Midkine functions as a heparin-binding growth factor that participates in various biological processes. The protein plays what seems to be a crucial role in cell proliferation, migration, and angiogenesis. Its significance likely extends to developmental and repair pathways, making it an important target for scientific studies focused on cellular growth and tissue regeneration.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Chicken Midkine is a heparin-binding growth factor that requires precise folding, proper disulfide bond formation (with five conserved disulfide bonds), and specific tertiary structure for its functional activity in cell growth and differentiation. The E. coli expression system cannot provide the eukaryotic folding environment or oxidative conditions for correct disulfide bond formation. The dual N-terminal 10xHis-tag (∼1 kDa) and C-terminal Myc-tag (∼1.2 kDa) are relatively small but may still interfere with the protein's functional domains and receptor-binding interfaces. While the mature protein region (22-142aa) is complete, the probability of correct folding with functional activity is low without experimental validation of disulfide bond formation.

1. Protein-Protein Interaction Studies Using Pull-Down Assays

This application carries a significant risk without proper folding validation. Midkine interactions with heparin and cell surface receptors require precise tertiary structure and proper disulfide bonding. If correctly folded (verified through heparin-binding assays), the protein may identify physiological interaction partners. If misfolded/unverified, there is a high risk of non-specific binding or failure to replicate genuine receptor interactions.

2. Antibody Development and Validation

This application is highly suitable as antibody development relies on antigenic sequence recognition rather than functional protein folding. The mature protein provides comprehensive epitope coverage for generating antibodies against chicken midkine. The dual tags offer additional epitopes for screening and validation.

3. Comparative Protein Structure and Function Analysis

Meaningful comparative studies require native protein conformation and functional activity. If correctly folded and active (verified), the protein enables valid evolutionary comparisons. If misfolded/inactive (unverified), comparative analyses would yield misleading insights about midkine conservation and divergence across species.

4. ELISA Development and Quantitative Assays

This application is well-suited for developing detection assays. The protein serves as an excellent standard for quantitative midkine detection, as immunoassays depend on epitope recognition rather than functional conformation. The dual tags provide flexible detection options.

5. Cell Culture Supplementation Studies

This application carries a high risk without functional validation. Midkine's biological activity in cell culture requires native conformation and proper receptor binding. If incorrectly folded, the protein will not elicit proper cellular responses and may yield biologically misleading results.

Final Recommendation & Action Plan

The E. coli-expressed chicken midkine with dual tags may not be properly folded for functional applications due to the lack of eukaryotic disulfide bond formation machinery. Begin with functional validation using heparin-binding assays and cell-based activity tests to confirm bioactivity before considering Applications 1, 3, and 5. Applications 2 and 4 (antibody development and ELISA) can proceed immediately. If bioactivity is low, consider refolding protocols or use mammalian-expressed midkine for critical functional studies. Always include positive controls with bioactive midkine to validate experimental systems.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Has mitogenic activity, and neurite extension activity for PC12 cells.
Subcellular Location
Cell surface. Secreted, extracellular space, extracellular matrix, basement membrane. Note=Basement membranes in early embryonic tissues, and cell surface of neuroectodermal cells.
Protein Families
Pleiotrophin family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*