Recombinant Chlamydia trachomatis Small cysteine-rich outer membrane protein OmcA(OmcA)

In Stock
Code CSB-EP316432DSB
Product Type Recombinant Protein
Size US$2466Purchase it in Cusabio online store
(only available for customers from the US)
Uniprot No. P0CC05
Lead Time 3-7 business days
Relevance In elementary bodies (EBs, the infectious stage, which is able to survive outside the host cell) provides the structural integrity of the outer envelope through disulfide cross-links with the large cysteine-rich periplasmic protein and the major outer membrane porin. It has been described in publications as the Sarkosyl-insoluble COMC (Chlamydia outer membrane complex), and serves as the functional equivalent of peptidoglycan (By similarity).
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias 9 kDa cysteine-rich lipoprotein Short name:9kDa-CRP
Species Chlamydia trachomatis (strain D/UW-3/Cx)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence CCRIVDCCFEDPCAPIQCSPCESKKKDVDGGCNSCNGYVPACKPCGGDTHQDAKHGPQARGIPVDGKCRQ
Research Area Microbiology
Source E.coli
Gene Names omcA
Protein Names Recommended name: Small cysteine-rich outer membrane protein omcA Short name= Small-CRP Alternative name(s): 9 kDa cysteine-rich lipoprotein Short name= 9kDa-CRP
Expression Region 19-88aa
Tag Info N-terminal 6xHis-SUMO-tagged
Mol. Weight 23.4kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function In elementary bodies (EBs, the infectious stage, which is able to survive outside the host cell) provides the structural integrity of the outer envelope through disulfide cross-links with the large cysteine-rich periplasmic protein and the major outer membrane porin. It has been described in publications as the Sarkosyl-insoluble COMC (Chlamydia outer membrane complex), and serves as the functional equivalent of peptidoglycan (By similarity).
Subcellular Location Cell outer membrane, Lipid-anchor
Database Links

KEGG: ctr:CT_444

Related Products

omcA Antibodies

omcA Antibodies for Chlamydia trachomatis (strain D/UW-3/Cx)

omcA Proteins

omcA Proteins for Chlamydia trachomatis (strain D/UW-3/Cx)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.