Purity
Greater than 90% as determined by SDS-PAGE.
Research Area
Microbiology
Alternative Names
omcA; omp2A; omp3; CT_444; Small cysteine-rich outer membrane protein OmcA; Small-CRP; 9 kDa cysteine-rich lipoprotein; 9kDa-CRP
Species
Chlamydia trachomatis (strain D/UW-3/Cx)
Expression Region
19-88aa
Target Protein Sequence
CCRIVDCCFEDPCAPIQCSPCESKKKDVDGGCNSCNGYVPACKPCGGDTHQDAKHGPQARGIPVDGKCRQ
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
The expression region of this recombinant Chlamydia trachomatis (strain D/UW-3/Cx) omcA covers amino acids 19-88. This omcA protein is expected to have a theoretical molecular weight of 23.4 kDa. This protein is generated in a e.coli-based system. The N-terminal 6xHis-SUMO tag was smoothly integrated into the coding gene of omcA, which enables a simple process of detecting and purifying the omcA recombinant protein in the following steps.
The small cysteine-rich outer membrane protein OmcA is a component of the outer membrane of Chlamydia trachomatis, an obligate intracellular bacterium that causes various human diseases, including sexually transmitted infections and trachoma. OmcA is characterized by its small size and the presence of cysteine residues in its structure. The outer membrane proteins of Chlamydia play important roles in interactions with host cells and the immune system, contributing to the pathogenesis of chlamydial infections. OmcA, like other outer membrane proteins, is a potential target for understanding the host-pathogen interactions and developing strategies for intervention or vaccination.