Recombinant Chlamydia trachomatis Small cysteine-rich outer membrane protein OmcA (OmcA)

In Stock
Code CSB-EP316432DSB
Abbreviation Recombinant Chlamydia trachomatis omcA protein
MSDS
Size US$388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
omcA
Uniprot No.
Research Area
Microbiology
Alternative Names
omcA; omp2A; omp3; CT_444; Small cysteine-rich outer membrane protein OmcA; Small-CRP; 9 kDa cysteine-rich lipoprotein; 9kDa-CRP
Species
Chlamydia trachomatis (strain D/UW-3/Cx)
Source
E.coli
Expression Region
19-88aa
Target Protein Sequence
CCRIVDCCFEDPCAPIQCSPCESKKKDVDGGCNSCNGYVPACKPCGGDTHQDAKHGPQARGIPVDGKCRQ
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
23.4kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The expression region of this recombinant Chlamydia trachomatis (strain D/UW-3/Cx) omcA covers amino acids 19-88. This omcA protein is expected to have a theoretical molecular weight of 23.4 kDa. This protein is generated in a e.coli-based system. The N-terminal 6xHis-SUMO tag was smoothly integrated into the coding gene of omcA, which enables a simple process of detecting and purifying the omcA recombinant protein in the following steps.

The small cysteine-rich outer membrane protein OmcA is a component of the outer membrane of Chlamydia trachomatis, an obligate intracellular bacterium that causes various human diseases, including sexually transmitted infections and trachoma. OmcA is characterized by its small size and the presence of cysteine residues in its structure. The outer membrane proteins of Chlamydia play important roles in interactions with host cells and the immune system, contributing to the pathogenesis of chlamydial infections. OmcA, like other outer membrane proteins, is a potential target for understanding the host-pathogen interactions and developing strategies for intervention or vaccination.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
In elementary bodies (EBs, the infectious stage, which is able to survive outside the host cell) provides the structural integrity of the outer envelope through disulfide cross-links with the large cysteine-rich periplasmic protein and the major outer membrane porin. It has been described in publications as the Sarkosyl-insoluble COMC (Chlamydia outer membrane complex), and serves as the functional equivalent of peptidoglycan.
Subcellular Location
Cell outer membrane; Lipid-anchor. Note=The protein moiety probably penetrates into the periplasm.
Database Links

KEGG: ctr:CT_444

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*