Recombinant Clostridium symbiosum Pyruvate, phosphate dikinase (ppdK), partial

In Stock
Code CSB-EP334941CMM
Abbreviation Recombinant Clostridium symbiosum ppdK protein, partial
MSDS
Size $388
Order now
Image
  • Warning: preg_replace(): Unknown modifier 'a' in /www/wwwroot/cusabio.com/caches/caches_template/20141113/content/show_product_protein.php on line 156
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
ppdK
Uniprot No.
Research Area
others
Alternative Names
Pyruvate, orthophosphate dikinase
Species
Clostridium symbiosum (Bacteroides symbiosus)
Source
E.coli
Expression Region
384-511aa
Target Protein Sequence
AALKAGEVIGSALPASPGAAAGKVYFTADEAKAAHEKGERVILVRLETSPEDIEGMHAAEGILTVRGGMTSHAAVVARGMGTCCVSGCGEIKINEEAKTFELGGHTFAEGDYISLDGSTGKIYKGDIE
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
20.5 kDa
Protein Length
Partial
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Clostridium symbiosum Pyruvate, phosphate dikinase (ppdK) is produced in E. coli and includes both an N-terminal 10xHis tag and a C-terminal Myc tag for straightforward purification and detection. This partial protein covers amino acids 384 to 511 and is purified to over 90% homogeneity, as confirmed by SDS-PAGE. The product is designed solely for research use and appears to offer reliable quality and consistency for experimental applications.

Pyruvate, phosphate dikinase plays a critical role in metabolic pathways by catalyzing the conversion of pyruvate to phosphoenolpyruvate. This enzyme is integral to energy metabolism and carbon fixation processes, which makes it a crucial component of research into microbial metabolic pathways and enzymatic regulation. Understanding its function and mechanics seems vital for studies in bioenergetics and microbial physiology.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

1. Antibody Development and Immunoassay Research

This recombinant ppdK fragment (384-511aa) with dual His and Myc tags can serve as an immunogen for generating specific antibodies against Clostridium symbiosum pyruvate, phosphate dikinase. The N-terminal His tag allows efficient purification for immunization protocols. Meanwhile, the C-terminal Myc tag provides an additional epitope for antibody validation studies. Researchers can use this protein to develop polyclonal or monoclonal antibodies for studying ppdK expression and localization in bacterial systems. The >90% purity likely makes it suitable for immunization without significant contaminating proteins that could generate cross-reactive antibodies.

2. Protein-Protein Interaction Studies

The dual-tagged nature of this recombinant protein makes it valuable for investigating potential protein partners of the ppdK C-terminal domain in bacterial metabolic pathways. The His tag allows for nickel-affinity pull-down experiments using bacterial lysates to identify interacting proteins. The Myc tag then confirms protein capture through Western blotting. This partial protein fragment may retain important protein-binding domains that could reveal novel regulatory mechanisms or metabolic complexes involving pyruvate, phosphate dikinase. High purity levels suggest minimal background binding in interaction assays.

3. Epitope Mapping and Structural Domain Analysis

This specific fragment (384-511aa) represents a defined region of the full-length ppdK protein. Scientists can use it to map functional or antigenic epitopes within this C-terminal domain. Researchers might perform limited proteolysis experiments, cross-linking studies, or hydrogen-deuterium exchange analysis to characterize the structural properties of this domain. The dual tags make detection and purification straightforward throughout these analytical procedures. Such studies could provide insights into the modular organization of pyruvate, phosphate dikinase and identify critical regions for enzyme function or regulation.

4. Comparative Biochemical Analysis

This recombinant fragment can serve as a reference standard for comparative studies of pyruvate, phosphate dikinase variants across different bacterial species or mutant strains. The standardized expression system and purification tags allow for consistent preparation and quantification of the protein for biochemical characterization experiments. Researchers can analyze thermal stability, pH sensitivity, or chemical modification patterns of this specific domain compared to corresponding regions from other organisms. The >90% purity appears to ensure reliable and reproducible results in comparative biochemical assays.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Catalyzes the reversible phosphorylation of pyruvate and phosphate. In E.histolytica and C.symbiosus, PPDK functions in the direction of ATP synthesis.
Protein Families
PEP-utilizing enzyme family
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*