Recombinant Clostridium symbiosum Pyruvate, phosphate dikinase (ppdK), partial

In Stock
Code CSB-EP334941CMM
Abbreviation Recombinant Clostridium symbiosum ppdK protein, partial
MSDS
Size $388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
ppdK
Uniprot No.
Research Area
others
Alternative Names
Pyruvate, orthophosphate dikinase
Species
Clostridium symbiosum (Bacteroides symbiosus)
Source
E.coli
Expression Region
384-511aa
Target Protein Sequence
AALKAGEVIGSALPASPGAAAGKVYFTADEAKAAHEKGERVILVRLETSPEDIEGMHAAEGILTVRGGMTSHAAVVARGMGTCCVSGCGEIKINEEAKTFELGGHTFAEGDYISLDGSTGKIYKGDIE
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
20.5 kDa
Protein Length
Partial
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Clostridium symbiosum Pyruvate, phosphate dikinase (ppdK) is produced in E. coli and includes both an N-terminal 10xHis tag and a C-terminal Myc tag for straightforward purification and detection. This partial protein covers amino acids 384 to 511 and is purified to over 90% homogeneity, as confirmed by SDS-PAGE. The product is designed solely for research use and appears to offer reliable quality and consistency for experimental applications.

Pyruvate, phosphate dikinase plays a critical role in metabolic pathways by catalyzing the conversion of pyruvate to phosphoenolpyruvate. This enzyme is integral to energy metabolism and carbon fixation processes, which makes it a crucial component of research into microbial metabolic pathways and enzymatic regulation. Understanding its function and mechanics seems vital for studies in bioenergetics and microbial physiology.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Clostridium symbiosum Pyruvate, phosphate dikinase (ppdK) is a bacterial enzyme that requires precise folding and proper domain interactions for its functional activity in the phosphoenolpyruvate synthesis pathway. The E. coli expression system is homologous for this bacterial protein, increasing the probability of correct folding. However, this recombinant protein represents only a partial fragment (384-511aa) of the full-length enzyme, which may lack complete structural context and functional domains. The dual N-terminal 10xHis-tag and C-terminal Myc-tag may sterically interfere with the protein's folding or functional sites. While bacterial expression provides favorable conditions, the partial nature of the construct requires experimental validation to confirm structural integrity.

1. Antibody Development and Immunoassay Research

This application is highly suitable as antibody development primarily relies on antigenic sequence recognition. The partial fragment provides specific epitopes within the 384-511aa region, making it excellent for generating antibodies targeting this particular domain. The dual tags facilitate purification and provide additional epitopes for antibody validation.

2. Protein-Protein Interaction Studies

This application carries a significant risk due to the partial nature of the protein. Protein-protein interactions require proper tertiary structure that may be compromised in this partial fragment. If correctly folded (verified), the fragment might identify domain-specific interaction partners. If misfolded/unverified, there is a high risk of non-specific binding or failure to present genuine interaction interfaces.

3. Epitope Mapping and Structural Domain Analysis

Domain analysis focuses on local structural features rather than complete protein functionality. This application is well-suited for characterizing the structural properties of this specific domain. Techniques like limited proteolysis and cross-linking can map domain boundaries and structural features regardless of full protein context.

4. Comparative Biochemical Analysis

Comparative analysis of defined domains can provide insights into the evolutionary conservation of structural features. This application is suitable for comparative studies of this specific domain across species. The standardized expression allows consistent preparation for comparing thermal stability and biochemical properties of the 384-511aa region.

Final Recommendation & Action Plan

The E. coli expression system is suitable for this bacterial protein fragment, but the partial nature of the construct requires careful consideration of the application scope. Begin with biochemical characterization to assess folding quality through techniques like circular dichroism spectroscopy and size-exclusion chromatography. Application 1 (Antibody Development), Application 3 (Epitope Mapping), and Application 4 (Comparative Analysis) can proceed immediately as they don't require full protein functionality. For Application 2 (Protein-Protein Interactions), first validate that the fragment maintains proper folding and then proceed cautiously with appropriate controls. Focus on domain-specific studies rather than full protein functionality, and use this reagent primarily for structural and immunological applications rather than complete enzymatic function studies.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Catalyzes the reversible phosphorylation of pyruvate and phosphate. In E.histolytica and C.symbiosus, PPDK functions in the direction of ATP synthesis.
Protein Families
PEP-utilizing enzyme family
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*