Recombinant Crotalus adamanteus Snake venom metalloproteinase adamalysin-2

In Stock
Code CSB-EP330325DYB
Abbreviation Recombinant Crotalus adamanteus Snake venom metalloproteinase adamalysin-2 protein
MSDS
Size US$388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Uniprot No.
Alternative Names
; Snake venom metalloproteinase adamalysin-2; SVMP; EC 3.4.24.46; Adamalysin II; Proteinase II
Species
Crotalus adamanteus (Eastern diamondback rattlesnake)
Source
E.coli
Expression Region
1-203aa
Target Protein Sequence
QQNLPQRYIELVVVADRRVFMKYNSDLNIIRTRVHEIVNIINGFYRSLNIDVSLVNLEIWSGQDPLTIQSSSSNTLNSEGLWREKVLLNKKKKDNAQLLTAIEFKCETLGKAYLNSMCNPRSSVGIVKDHSPINLLVAVTMAHELGHNLGMEHDGKDCLRGASLCIMRPGLTPGRSYEFSDDSMGYYQKFLNQYKPQCILNKP
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
27.1kDa
Protein Length
Full Length
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Producing recombinant Crotalus adamanteus Snake venom metalloproteinase adamalysin-2 first isolates the target gene, which covers the full-length Snake venom metalloproteinase adamalysin-2 (1-203aa). This gene is co-cloned into an appropriate expression vector with an N-terminal 6xHis-tag gene and introduced into E. coli cells. The positive E. coli cells are cultured to express the recombinant protein. After that, these cells undergo lysis to release the protein. Purification of the protein is typically achieved using affinity chromatography. The purity of the recombinant Snake venom metalloproteinase adamalysin-2 is over 90% as determined by SDS-PAGE.

Crotalus adamanteus adamalysin-2 is a significant component found in the venom of the Crotalus adamanteus. This protein belongs to the adamalysin or ADAM family, which includes proteolytic domains found in snake venom metalloproteinases, mammalian reproductive tract proteins, and tumor necrosis factor-alpha convertase (TACE) [1]. Adamalysin-2 is a 24 kDa zinc endopeptidase that is part of a large family of metalloproteinases and is crucial for various biological activities, requiring Zn2+ and Ca2+ as cofactors [2]. It is a well-known metalloendopeptidase toxin that can be inhibited by certain molecules like Jatromollistatin, a cyclic heptapeptide, as demonstrated through molecular docking analysis [3].

References:
[1] F. Gomis‐Rüth, E. Meyer, L. Kress, & V. Politi, Structures of adamalysin ii with peptidic inhibitors. implications for the design of tumor necrosis factor α convertase inhibitors, Protein Science, vol. 7, no. 2, p. 283-292, 1998. https://doi.org/10.1002/pro.5560070207
[2] P. Phan, A review of rattlesnake venoms, Toxins, vol. 16, no. 1, p. 2, 2023. https://doi.org/10.3390/toxins16010002
[3] T. Jucá, M. Ramos, E. Cilli, A. Neto, S. Mackessy, & A. Monteiro-Moreira, Insights on the inhibition properties ofjatromollistatin(a cyclic heptapeptide) againstcrotalus adamanteusmetalloendopeptidase using molecular docking analysis, Journal of Molecular Recognition, vol. 35, no. 7, 2022. https://doi.org/10.1002/jmr.2957

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Has no significant hemorrhagic activity, but inactivates serpins by limited proteolysis of their reactive-site loops.
Subcellular Location
Secreted.
Protein Families
Venom metalloproteinase (M12B) family, P-I subfamily
Tissue Specificity
Expressed by the venom gland.
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*