Recombinant Crotalus atrox Snake venom serine protease catroxase-2

In Stock
Code CSB-YP854470DYC
Abbreviation Recombinant Crotalus atrox Snake venom serine protease catroxase-2 protein
MSDS
Size $436
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 85% as determined by SDS-PAGE.
Target Names
N/A
Uniprot No.
Research Area
others
Alternative Names
Catroxase II Kallikrein-like EI
Species
Crotalus atrox (Western diamondback rattlesnake)
Source
Yeast
Expression Region
25-258aa
Target Protein Sequence
VVGGDECNINEHRSLVAIFNSTEFFCSGTLINQEWVVTAAHCDSTNFKMKLGVHSKKVPNEDEQTRNPKEKFFCPNKKKDDVLDKDIMLIKLDSPVSNSEHIAPLSLPSSPPSVGSVCHIMGWGSITPIEKTLPDVPYCANIKLLDDAVCQPPYPELPATSRTLCAGIPEGGKDTCGGDSGGPLICNGQFQGIVFYGAHPCGQALKPGVYTKVFDYNDWIQSIIAGNTAATCPP
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
27.2 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The expression of the recombinant Crotalus atrox Snake venom serine protease catroxase-2 involves the construction of a plasmid encoding the Crotalus atrox Snake venom serine protease catroxase-2 (25-258aa) and the N-terminal 6xHis-tag. This resulting plasmid is introduced into yeast cells. Positive yeast cells are selected and cultured for protein expression. After that, cultured cells are lysed. The subsequent step includes purifying the recombinant Crotalus atrox Snake venom serine protease catroxase-2 protein through affinity purification from the cell lysate and assessing the purity of the protein via SDS-PAGE. The purity of the recombinant Snake venom serine protease catroxase-2 is greater than 85%.

Snake venom serine proteases (SVSPs) are key players in snake venom, especially in viperid snakes, and are central to how venom works. They belong to a group of enzymes called the S1 family of serine proteinases and come in various sizes, typically between 26 and 67 kilodaltons, with two distinct structural parts [1]. These enzymes mess with the body's blood clotting system in several ways, like breaking down fibrinogen and activating protein C into activated protein C [2][3][4]. One reason they're so effective is that they remain stable across a wide range of pH levels, which helps them do their job well in an envenomation [5]. Even though SVSPs look similar at the amino acid level, they can have different jobs and targets, indicating they're not all the same [6]. By breaking down fibrin(ogen), SVSPs prevent blood from clotting, making it easier for other toxins in the venom to spread throughout the victim's body [3]. Scientists are interested in SVSPs for drug development, especially for making antivenoms [1]. They're also looking into the three-dimensional structures of SVSPs, hoping to find clues for new medicines [7]. Overall, SVSPs are crucial components of snake venom, causing complex effects in envenomations and offering potential opportunities for treatments.

References:
[1] A. Funmilola, G. Abubakar, & Z. Hassan, Molecular docking in drug discovery: a review on anti-snake venom development, International Journal of Biochemistry Research & Review, p. 42-49, 2020. https://doi.org/10.9734/ijbcrr/2020/v29i330179
[2] T. Kang, D. Georgieva, N. Genov, M. Murakami, M. Sinha, R. Kumaret al., Enzymatic toxins from snake venom: structural characterization and mechanism of catalysis, Febs Journal, vol. 278, no. 23, p. 4544-4576, 2011. https://doi.org/10.1111/j.1742-4658.2011.08115.x
[3] Y. Choo, K. Lee, H. Yoon, B. Kim, M. Sohn, J. Rohet al., Dual function of a bee venom serine protease: prophenoloxidase-activating factor in arthropods and fibrin(ogen)olytic enzyme in mammals, Plos One, vol. 5, no. 5, p. e10393, 2010. https://doi.org/10.1371/journal.pone.0010393
[4] A. Leme, B. Prezoto, E. Yamashiro, L. Bertholim, A. Tashima, C. Klitzkeet al., Protease a, a unique highly glycosylated serine proteinase, is a potent, specific fibrinogenolytic agent, Journal of Thrombosis and Haemostasis, vol. 6, no. 8, p. 1363-1372, 2008. https://doi.org/10.1111/j.1538-7836.2008.02995.x
[5] P. Sukkapan, Y. Jia, I. Nuchprayoon, & J. Perez, Phylogenetic analysis of serine proteases from russell’s viper (daboia russelli siamensis) and agkistrodon piscivorus leucostoma venom, Toxicon, vol. 58, no. 2, p. 168-178, 2011. https://doi.org/10.1016/j.toxicon.2011.05.014
[6] S. Vaiyapuri, S. Wagstaff, R. Harrison, J. Gibbins, & E. Hutchinson, Evolutionary analysis of novel serine proteases in the venom gland transcriptome of bitis gabonica rhinoceros, Plos One, vol. 6, no. 6, p. e21532, 2011. https://doi.org/10.1371/journal.pone.0021532
[7] Z. Zhu, Z. Liang, T. Zhang, Z. Zhu, W. Xu, M. Tenget al., Crystal structures and amidolytic activities of two glycosylated snake venom serine proteinases, Journal of Biological Chemistry, vol. 280, no. 11, p. 10524-10529, 2005. https://doi.org/10.1074/jbc.m412900200

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Snake venom serine protease that may act in the hemostasis system of the prey.
Subcellular Location
Secreted.
Protein Families
Peptidase S1 family, Snake venom subfamily
Tissue Specificity
Expressed by the venom gland.
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*