Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

N/A

Uniprot No.

P93124

Research Area

Others

Alternative Names

Pollen allergen Dac g 3; Allergen Dac g III; allergen Dac g 3; Fragment

Species

Dactylis glomerata (Orchard grass) (Cock's-foot grass)

Source

Yeast

Expression Region

1-96aa

Target Protein Sequence

VKVTFKVEKGSDPKKLVLDIKYTRPGDTLAEVELRQHGSEEWEPLTKKGNLWEVKSSKPLTGPFNFRFMSKGGMRNVFDEVIPTAFKIGTTYTPEE
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

12.9kDa

Protein Length

Partial

Tag Info

N-terminal 6xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

Recombinant Dactylis glomeRata Pollen allergen Dac g 3 production in yeast involves co-cloning the gene of interest (1-96aa of Dactylis glomeRata Pollen allergen Dac g 3) into an expression vector with an N-terminal 6xHis-tag gene, followed by transformation into yeast cells. These cells are cultured under conditions that induce protein expression. Once sufficient growth is achieved, the cells are lysed to extract the recombinant protein. Purification is achieved using the affinity chromatography method. The purity of the protein is assessed using SDS-PAGE, greater than 90%.

Dactylis glomerata pollen allergen Dac g 3 is a significant allergen found in the pollen of Orchard or Dactylis glomerata. Studies have shown that Dac g 3 is a major allergen recognized by the serum of a high percentage of individuals sensitive to D. glomerata pollen [1]. This allergen has been isolated and characterized, demonstrating its potency in triggering allergic reactions in individuals exposed to D. glomerata pollen [1]. Furthermore, research has focused on identifying and characterizing various allergens present in D. glomerata pollen, highlighting the importance of understanding the allergenic components of this pollen species [2].

References:

[1] S. Mécheri, G. Peltre, & B. David, Purification and characterization of a major allergen from dactylis glomerata pollen: the ag dg1, International Archives of Allergy and Immunology, vol. 78, no. 3, p. 283-289, 1985. https://doi.org/10.1159/000233899

[2] S. Ford, E. Tovey, & B. Baldo, Identification of orchard grass (dactylis glomerata) pollen allergens following electrophoretic transfer to nitrocellulose, International Archives of Allergy and Immunology, vol. 78, no. 1, p. 15-21, 1985. https://doi.org/10.1159/000233855

Code	CSB-YP309006DAC
Abbreviation	Recombinant Dactylis glomerata Pollen allergen Dac g 3 protein, partial
MSDS	MSDS Datasheet
Size	$436
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Dactylis glomeRata Pollen allergen Dac g 3, partial

Product Details

Customer Reviews and Q&A

Target Background

×CloseMessage