Recombinant Dactylis glomeRata Pollen allergen Dac g 3, partial

In Stock
Code CSB-YP309006DAC
Abbreviation Recombinant Dactylis glomerata Pollen allergen Dac g 3 protein, partial
MSDS
Size $436
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
N/A
Uniprot No.
Research Area
Others
Alternative Names
Pollen allergen Dac g 3; Allergen Dac g III; allergen Dac g 3; Fragment
Species
Dactylis glomerata (Orchard grass) (Cock's-foot grass)
Source
Yeast
Expression Region
1-96aa
Target Protein Sequence
VKVTFKVEKGSDPKKLVLDIKYTRPGDTLAEVELRQHGSEEWEPLTKKGNLWEVKSSKPLTGPFNFRFMSKGGMRNVFDEVIPTAFKIGTTYTPEE
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
12.9kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
Recombinant Dactylis glomeRata Pollen allergen Dac g 3 production in yeast involves co-cloning the gene of interest (1-96aa of Dactylis glomeRata Pollen allergen Dac g 3) into an expression vector with an N-terminal 6xHis-tag gene, followed by transformation into yeast cells. These cells are cultured under conditions that induce protein expression. Once sufficient growth is achieved, the cells are lysed to extract the recombinant protein. Purification is achieved using the affinity chromatography method. The purity of the protein is assessed using SDS-PAGE, greater than 90%.
 
Dactylis glomerata pollen allergen Dac g 3 is a significant allergen found in the pollen of Orchard or Dactylis glomerata. Studies have shown that Dac g 3 is a major allergen recognized by the serum of a high percentage of individuals sensitive to D. glomerata pollen [1]. This allergen has been isolated and characterized, demonstrating its potency in triggering allergic reactions in individuals exposed to D. glomerata pollen [1]. Furthermore, research has focused on identifying and characterizing various allergens present in D. glomerata pollen, highlighting the importance of understanding the allergenic components of this pollen species [2].
 
References:
[1] S. Mécheri, G. Peltre, & B. David, Purification and characterization of a major allergen from <i>dactylis glomerat</i><i>a</i> pollen: the ag dg1, International Archives of Allergy and Immunology, vol. 78, no. 3, p. 283-289, 1985. https://doi.org/10.1159/000233899
[2] S. Ford, E. Tovey, & B. Baldo, Identification of orchard grass <i>(dactylis glomerata)</i> pollen allergens following electrophoretic transfer to nitrocellulose, International Archives of Allergy and Immunology, vol. 78, no. 1, p. 15-21, 1985. https://doi.org/10.1159/000233855

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Subcellular Location
Secreted.
Protein Families
Expansin family, Expansin B subfamily
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*