Recombinant Dahlia merckii Defensin-like protein 1

In Stock
Code CSB-EP316614DAE
Abbreviation Recombinant Dahlia merckii Defensin-like protein 1 protein
MSDS
Size US$388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Uniprot No.
Research Area
others
Alternative Names
Defensin-like protein 1; Cysteine-rich antimicrobial protein 1; Defensin AMP1; DmAMP1
Species
Dahlia merckii (Bedding dahlia)
Source
E.coli
Expression Region
1-50aa
Target Protein Sequence
ELCEKASKTWSGNCGNTGHCDNQCKSWEGAAHGACHVRNGKHMCFCYFNC
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
19.5kDa
Protein Length
Full Length
Tag Info
N-terminal 6xHis-B2M-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Dahlia merckii Defensin-like protein 1 is produced in E. coli and features an N-terminal 6xHis-B2M tag for easier purification and detection. The protein appears to be expressed as a full-length peptide covering amino acids 1 to 50, achieving what seems to be a purity level exceeding 90%, as verified by SDS-PAGE analysis. This product is intended for research use only.

Defensin-like proteins are small, cysteine-rich peptides that likely play a role in the innate immune response of plants. They may participate in various defense mechanisms by disrupting pathogen cell membranes. These proteins could prove valuable in research focused on plant immunity, offering insights into pathogen resistance and potential applications in agriculture.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Dahlia merckii defensin-like protein 1 is a small cysteine-rich protein that requires precise folding, proper disulfide bond formation (typically with 3-4 conserved disulfide bonds), and specific tertiary structure for its antimicrobial activity. The E. coli expression system cannot provide the eukaryotic oxidative environment for correct disulfide bond formation. The large N-terminal 6xHis-B2M tag (∼12 kDa B2M plus His-tag) is significantly larger than the defensin itself (∼6 kDa) and will severely sterically interfere with the protein's functional domains and antimicrobial activity. The probability of correct folding with functional activity is extremely low.

This B2M-tagged defensin construct is fundamentally unsuitable for defensin research due to the severe steric interference from the massive tag relative to the small defensin size, combined with the inability of E. coli to form the essential disulfide bonds required for defensin functionality. All functional applications should be avoided. The only limited application is generating antibodies, though the response will be dominated by anti-tag antibodies. For reliable defensin research, use tag-free defensin produced by chemical synthesis or eukaryotic expression systems that support proper disulfide bond formation.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Possesses antimicrobial activity sensitive to inorganic cations. Has no inhibitory effect on insect gut alpha-amylase. Induces potential changes in fungal membranes and increased K+ efflux and Ca(2+) uptake. Interacts with sphingolipids and ergosterols found in fungal plasma membranes.
Subcellular Location
Secreted.
Protein Families
DEFL family
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*