Recombinant Dog Chymase(CMA1)

Code CSB-EP005599DO
Product Type Recombinant Protein
Size US$2466
Uniprot No. P21842
Relevance Major secreted protease of mast cells with suspected roles in vasoactive peptide generation, Extracellular domain matrix degradation, and regulation of gland secretion.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias Alpha-chymase;Mast cell protease I
Species Canis lupus familiaris (Dog) (Canis familiaris)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence IIGGTESKPHSRPYMAHLEILTLRNHLASCGGFLIRRNFVLTAAHCAGRFIMVTLGAHNIQKKEDTWQKLEVIKQFPHPKYDDLTLRHDIMLLKLKEKANLTLAVGTLPLSPQFNFVPPGRMCRVAGWGKRQVNGSGSDTLQEVKLRLMDPQACRHYMAFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGQNDAKPPAVFTRISHYRPWINKVLKQNKA
Research Area Others
Source E.coli
Gene Names CMA1
Expression Region 22-249aa
Tag Info N-terminal 6xHis-SUMO-tagged
Mol. Weight 41.5kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Major secreted protease of mast cells with suspected roles in vasoactive peptide generation, extracellular matrix degradation, and regulation of gland secretion.
Subcellular Location Secreted, Cytoplasmic granule
Protein Families Peptidase S1 family, Granzyme subfamily
Database Links

KEGG: cfa:490628

STRING: 9615.ENSCAFP00000018316

UniGene: Cfa.16336

Pathway Renin-angiotensin system

Related Products

CMA1 Antibodies

CMA1 Antibodies for Canis lupus familiaris (Dog) (Canis familiaris)

CMA1 Proteins

CMA1 Proteins for Canis lupus familiaris (Dog) (Canis familiaris)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.