Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

CMA1

Uniprot No.

P21842

Research Area

Others

Alternative Names

CMA1Chymase; EC 3.4.21.39; Alpha-chymase; Mast cell protease I

Species

Canis lupus familiaris (Dog) (Canis familiaris)

Source

E.coli

Expression Region

22-249aa

Target Protein Sequence

IIGGTESKPHSRPYMAHLEILTLRNHLASCGGFLIRRNFVLTAAHCAGRFIMVTLGAHNIQKKEDTWQKLEVIKQFPHPKYDDLTLRHDIMLLKLKEKANLTLAVGTLPLSPQFNFVPPGRMCRVAGWGKRQVNGSGSDTLQEVKLRLMDPQACRHYMAFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGQNDAKPPAVFTRISHYRPWINKVLKQNKA
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

41.5kDa

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 6xHis-SUMO-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

The recombinant Dog CMA1 was expressed with the amino acid range of 22-249. This CMA1 protein is theoretically predicted to have a molecular weight of 41.5 kDa. The CMA1 protein was expressed in e.coli. The CMA1 gene fragment has been modified by fusing the N-terminal 6xHis-SUMO tag, providing convenience in detecting and purifying the recombinant CMA1 protein during the following stages.

The dog Chymase (CMA1), similar to its human counterpart, is a member of the chymase family of serine proteases. It is primarily known for its involvement in the renin-angiotensin system, where it participates in the conversion of angiotensin I to vasoconstrictor angiotensin II. Chymase is predominantly expressed in mast cells and plays a crucial role in immune responses, particularly in the activation of inflammatory pathways and the release of bioactive molecules. In addition to its role in cardiovascular regulation, chymase may contribute to tissue remodeling and fibrosis. Research on dog Chymase is essential for understanding its specific functions in canine physiology, which can have implications for cardiovascular health and potential therapeutic interventions in veterinary medicine.

Target Background

Function

Major secreted protease of mast cells with suspected roles in vasoactive peptide generation, extracellular matrix degradation, and regulation of gland secretion.

Gene References into Functions

Mast cell-derived chymase plays an essential role in pathogenesis of arteriovenous fistula access failure, and chymase inhibition may be therapeutic target for treatment of hemodialysis vascular access dysfunction. PMID: 15744002

Subcellular Location

Secreted. Cytoplasmic granule.

Protein Families

Peptidase S1 family, Granzyme subfamily

Database Links

KEGG: cfa:490628

STRING: 9615.ENSCAFP00000018316

UniGene: Cfa.16336

Code	CSB-EP005599DO
Abbreviation	Recombinant Dog CMA1 protein
MSDS	MSDS Datasheet
Size	US$388
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Dog Chymase (CMA1)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage