Purity
Greater than 90% as determined by SDS-PAGE.
Alternative Names
CMA1Chymase; EC 3.4.21.39; Alpha-chymase; Mast cell protease I
Species
Canis lupus familiaris (Dog) (Canis familiaris)
Expression Region
22-249aa
Target Protein Sequence
IIGGTESKPHSRPYMAHLEILTLRNHLASCGGFLIRRNFVLTAAHCAGRFIMVTLGAHNIQKKEDTWQKLEVIKQFPHPKYDDLTLRHDIMLLKLKEKANLTLAVGTLPLSPQFNFVPPGRMCRVAGWGKRQVNGSGSDTLQEVKLRLMDPQACRHYMAFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGQNDAKPPAVFTRISHYRPWINKVLKQNKA
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
The recombinant Dog CMA1 was expressed with the amino acid range of 22-249. This CMA1 protein is theoretically predicted to have a molecular weight of 41.5 kDa. The CMA1 protein was expressed in e.coli. The CMA1 gene fragment has been modified by fusing the N-terminal 6xHis-SUMO tag, providing convenience in detecting and purifying the recombinant CMA1 protein during the following stages.
The dog Chymase (CMA1), similar to its human counterpart, is a member of the chymase family of serine proteases. It is primarily known for its involvement in the renin-angiotensin system, where it participates in the conversion of angiotensin I to vasoconstrictor angiotensin II. Chymase is predominantly expressed in mast cells and plays a crucial role in immune responses, particularly in the activation of inflammatory pathways and the release of bioactive molecules. In addition to its role in cardiovascular regulation, chymase may contribute to tissue remodeling and fibrosis. Research on dog Chymase is essential for understanding its specific functions in canine physiology, which can have implications for cardiovascular health and potential therapeutic interventions in veterinary medicine.