Recombinant Dog Phospholipase A2 group XV (PLA2G15)

Code CSB-MP747694DO
Abbreviation Recombinant Dog PLA2G15 protein
MSDS
Size $256
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Epigenetics and Nuclear Signaling
Alternative Names
PLA2G15; LYPLA3Group XV phospholipase A2; EC 2.3.1.-; 1-O-acylceramide synthase; ACS; LCAT-like lysophospholipase; LLPL; Lysophospholipase 3; Lysosomal phospholipase A2; LPLA2
Species
Canis lupus familiaris (Dog) (Canis familiaris)
Source
Mammalian cell
Expression Region
32-408aa
Target Protein Sequence
RRPPVVLVPGDLGNQLEAKLDKPTVVHYLCSKRTESYFTLWLNLELLLPVIIDCWIDNIRLVYNRTSRATQFPDGVDVRVPGFGKTFSLEFLDPSKSSVGSYFHTMVESLVDWGYIRGEDVRGAPYDWRRAPNENGPYFLALREMIEEMYQLYGGPVVLVAHSMGNMYTLYFLQRQPQAWKNKYIQAFVALGAPWGGVAKTLRVLASGDNNRIPVIRPLKIREQQRSAVSTSWLLPYNYTWSPEKIFVHTPTANYTLRDYHQFFQDIGFKDGWLMRQDTEGLVEAMVPPGVPLHCLYGTGVPTPDSFYYESFPDRDPKICFGDGDGTVNLQSALQCQAWRGHQEHQVSLQALPGSEHIEMLANATTLAYLKRVLLGP
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
47.9 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
18-28 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

In mammalian cells, the generation of recombinant dog phospholipase A2 group XV (PLA2G15) involves cloning a DNA fragment encoding the dog PLA2G15 protein (32-408aa) into a plasmid vector along with the N-terminal 10xHis-tag and C-terminal Myc-tag gene, which is then transferred into the mammalian cells. Positive cells are selected, cultured, and induced to express the PLA2G15 protein. Lysis of the cells allows for the harvest of the recombinant dog PLA2G15 protein. The collected recombinant dog PLA2G15 protein is subjected to affinity purification and is identified using SDS-PAGE and subsequent staining of the gel with Coomassie Brilliant Blue. Its purity is greater than 90%.

PLA2G15 is a lysosomal enzyme with unique subcellular localization to the lysosome and late endosome [1]. PLA2G15 has multiple functions, including the regulation of adipocyte differentiation [2], synthesis of 1- O -acylceramide [3], hydrolysis of lysophosphatidylcholine to glycerophosphorylcholine and a free fatty acid [4], and catalyzing the hydrolysis and degradation of cellular phospholipids [5]. Furthermore, PLA2G15 regulates lysophospholipids and is present in exosomes [6].

Studies have also linked PLA2G15 to specific conditions and diseases. For instance, it has been identified as part of an eight-gene expression signature for predicting high Fuhrman-grade renal cell carcinoma [7]. Furthermore, a novel intergenically spliced chimera, NFATC3-PLA2G15, has been associated with aggressive T-cell acute lymphoblastic leukemia biology [8]. Moreover, PLA2G15 is upregulated in the acute phase of COVID-19, indicating its involvement in the innate immune host response during the early stages of the disease [9].

Furthermore, PLA2G15 has been implicated in lipid metabolism, as evidenced by its association with the metabolism of steroid hormones and glycerol phosphate [10]. PLA2G15 has also been shown to regulate BMP lipids in hepatocytes [11]. Additionally, PLA2G15 has been identified as part of proteins involved in bile acid metabolism and lipid metabolism processes.

References:
[1] J. Shayman and J. Tesmer, Lysosomal phospholipase a2, Biochimica Et Biophysica Acta (Bba) - Molecular and Cell Biology of Lipids, vol. 1864, no. 6, p. 932-940, 2019. https://doi.org/10.1016/j.bbalip.2018.07.012
[2] P. Wilson, S. Gardner, N. Lambie, S. Commans, & D. Crowther, Characterization of the human patatin-like phospholipase family, The Journal of Lipid Research, vol. 47, no. 9, p. 1940-1949, 2006. https://doi.org/10.1194/jlr.m600185-jlr200
[3] Y. Ohno, N. Kamiyama, S. Nakamichi, & A. Kihara, Pnpla1 is a transacylase essential for the generation of the skin barrier lipid ω-o-acylceramide, Nature Communications, vol. 8, no. 1, 2017. https://doi.org/10.1038/ncomms14610
[4] X. Guo, S. Zhou, Z. Yang, Z. Li, W. Hu, L. Daiet al., Comprehensive analysis of sterol o-acyltransferase 1 as a prognostic biomarker and its association with immune infiltration in glioma, Frontiers in Oncology, vol. 12, 2022. https://doi.org/10.3389/fonc.2022.896433
[5] I. Shahi, C. Llaneras, S. Perelman, V. Torres, & A. Ratner, Genome-wide crispr-cas9 screen does not identify host factors modulating streptococcus agalactiae β-hemolysin/cytolysin-induced cell death, Microbiology Spectrum, vol. 10, no. 1, 2022. https://doi.org/10.1128/spectrum.02186-21
[6] F. Wan, Y. Zhu, C. Han, Q. Xu, J. Wu, B. Daiet al., Identification and validation of an eight‐gene expression signature for predicting high fuhrman grade renal cell carcinoma, International Journal of Cancer, vol. 140, no. 5, p. 1199-1208, 2017. https://doi.org/10.1002/ijc.30535
[7] J. Bond, C. Quang, G. Hypolite, M. Belhocine, A. Bergon, G. Cordonnieret al., Novel intergenically spliced chimera, nfatc3-pla2g15, is associated with aggressive t-all biology and outcome, Molecular Cancer Research, vol. 16, no. 3, p. 470-475, 2018. https://doi.org/10.1158/1541-7786.mcr-17-0442
[8] A. Bauer, E. Pachl, J. Hellmuth, N. Kneidinger, M. Heydarian, M. Frankenbergeret al., Proteomics reveals antiviral host response and netosis during acute covid-19 in high-risk patients, Biochimica Et Biophysica Acta (Bba) - Molecular Basis of Disease, vol. 1869, no. 2, p. 166592, 2023. https://doi.org/10.1016/j.bbadis.2022.166592
[9] Y. Tang, Comparative analysis of different proteins and metabolites in the liver and ovary of local breeds of chicken and commercial chickens in the later laying period, International Journal of Molecular Sciences, vol. 24, no. 18, p. 14394, 2023. https://doi.org/10.3390/ijms241814394
[10] R. Jain, Modulation of hepatic transcription factor eb activity during cold exposure uncovers direct regulation of bis(monoacylglycero)phosphate lipids bypla2g15,, 2023. https://doi.org/10.1101/2023.11.03.565498
[11] L. Bai, J. Feng, X. Qiao, Y. Qu, J. Lyu, G. Yanget al., Plasma proteomic profiling of pan-cancer patients discovers biomarkers of cancers,, 2021. https://doi.org/10.21203/rs.3.rs-939549/v1

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Has dual calcium-independent phospholipase and O-acyltransferase activities with a potential role in glycerophospholipid homeostasis and remodeling of acyl groups of lipophilic alcohols present in acidic cellular compartments. Catalyzes hydrolysis of the ester bond of the fatty acyl group attached at sn-1 or sn-2 position of phospholipids (phospholipase A1 or A2 activity) and transfer it to the hydroxyl group at the first carbon of lipophilic alcohols (O-acyltransferase activity). Among preferred fatty acyl donors are phosphatidylcholines, phosphatidylethanolamines, phosphatidylglycerols and phosphatidylserines. Favors sn-2 over sn-1 deacylation of unsaturated fatty acyl groups of phosphatidylcholines and phosphatidylethanolamines. Among preferred fatty acyl acceptors are natural lipophilic alcohols including short-chain ceramide N-acetyl-sphingosine (C2 ceramide), alkylacylglycerols, monoacylglycerols, and acylethanolamides such as anandamide and oleoylethanolamide. Selectively hydrolyzes the sn-1 fatty acyl group of truncated oxidized phospholipids and may play a role in detoxification of reactive oxidized phospholipids during oxidative stress. Required for normal phospholipid degradation in alveolar macrophages with potential implications in pulmonary surfactant clearance. At neutral pH, hydrolyzes the sn-1 fatty acyl group of the lysophosphatidylcholines.
Gene References into Functions
  1. LPLA2 may function to remodel acyl groups and modulate the biological and pharmacological activities of some lipophilic alcohols PMID: 17626977
Subcellular Location
Secreted. Lysosome. Membrane; Peripheral membrane protein.
Protein Families
AB hydrolase superfamily, Lipase family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*