Recombinant Drosophila melanogaster Partner of bursicon (pburs)

In Stock
Code CSB-YP893290DLU
Abbreviation Recombinant Drosophila melanogaster pburs protein
MSDS
Size US$436
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Pburs
Uniprot No.
Research Area
Others
Alternative Names
Pburs; burs-beta; CG15284; Partner of bursicon; Bursicon subunit beta
Species
Drosophila melanogaster (Fruit fly)
Source
Yeast
Expression Region
21-141aa
Target Protein Sequence
LRYSQGTGDENCETLKSEIHLIKEEFDELGRMQRTCNADVIVNKCEGLCNSQVQPSVITPTGFLKECYCCRESFLKEKVITLTHCYDPDGTRLTSPEMGSMDIRLREPTECKCFKCGDFTR
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
15.8kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

This recombinant Drosophila melanogaster Partner of bursicon protein is produced in a yeast expression system, which appears to provide high fidelity to the native form. The protein comes with an N-terminal 6xHis tag that makes purification and detection more straightforward. The product spans the full length of the mature protein—specifically amino acids 21 to 141—and reaches a purity of greater than 90% as determined by SDS-PAGE. It's intended for research use only.

The Partner of the bursicon protein plays what seems to be a critical role in the post-molt hardening of the exoskeleton in Drosophila melanogaster. It works as a neuropeptide hormone, forming a heterodimer with bursicon, and appears to be involved in regulating cuticle sclerotization and wing expansion. This protein may prove pivotal in studies related to insect development and molting processes, potentially offering insights into endocrine signaling pathways.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

The recombinant Drosophila melanogaster Partner of bursicon (pburs, 21–141aa) expressed in yeast with an N-terminal 6×His tag represents the full-length mature protein, and yeast is generally capable of supporting correct folding and disulfide bond formation for small secreted proteins like pburs, which belongs to the cystine knot hormone family. However, pburs functions as a heterodimer with bursicon, and its biological activity depends on correct pairing with bursicon and proper cystine knot folding. While yeast can form disulfide bonds, it cannot guarantee proper folding or dimerization without co-expression of the bursicon partner. Therefore, this recombinant pburs is likely folded correctly as a monomer but unlikely to be biologically active in its natural functional form unless co-expressed or reconstituted with bursicon.

1. Protein-Protein Interaction Studies

This recombinant pburs protein can be used to study binding interactions between pburs and bursicon or other potential partners in Drosophila. The N-terminal 6×His tag allows immobilization for pull-down or co-immunoprecipitation assays. If the protein maintains correct folding, it may bind bursicon or other interacting proteins with native-like affinity. If misfolded or lacking its heterodimer partner, it can still serve as a screening tool for identifying possible interactions, but may not accurately reflect physiological binding. Therefore, functional verification through bursicon co-binding or ligand assays is recommended before interpreting binding results.

2. Antibody Development and Validation

This purified recombinant pburs protein is suitable for generating specific antibodies recognizing pburs. The >90% purity ensures consistent immunogenicity. If correctly folded, it will generate antibodies capable of recognizing native pburs conformations in Drosophila tissues. If misfolded, it will still be an effective linear-epitope immunogen, suitable for Western blot or ELISA applications. Thus, it is a reliable antigen for antibody production, though native binding validation should be done if the antibodies are intended for immunostaining or functional studies.

3. Biochemical Characterization and Structural Studies

The recombinant pburs protein can be used for biochemical characterization, such as determining molecular weight, stability, and secondary structure using circular dichroism or size exclusion chromatography. If folded correctly, it may provide insight into the cystine knot domain architecture and could be used for crystallography or NMR if monodisperse. If not properly folded, it remains useful for low-resolution biophysical profiling but not for detailed structural or functional analysis. The absence of its bursicon partner should be noted, as pburs forms a functional heterodimer in vivo.

Final Recommendation & Action Plan

The recombinant Drosophila pburs is likely to be properly folded as a monomeric cystine knot protein, but not biologically active on its own, as its functional role requires dimerization with bursicon. It is well-suited for antibody development, biochemical characterization, and interaction screening, but not for functional or receptor activation assays unless reconstituted with bursicon.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Final heterodimeric neurohormone released at the end of the molting cycle, involved in the sclerotization (tanning) of the insect cuticle, melanization and wing spreading. Heterodimer specifically activates the G protein-coupled receptor rk.
Subcellular Location
Secreted.
Tissue Specificity
Coexpressed with CCAP in most CCAP-specific neurons. Coexpressed with Burs in 4 bilateral neurons in thoracic and abdominal neuromeres of the ventral nervous system.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*