Recombinant Drosophila melanogaster Pro-resilin (resilin), partial

In Stock
Code CSB-EP892693DLU
Abbreviation Recombinant Drosophila melanogaster resilin protein, partial
MSDS
Size $388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
resilin
Uniprot No.
Research Area
Cardiovascular
Species
Drosophila melanogaster (Fruit fly)
Source
E.coli
Expression Region
342-620aa
Target Protein Sequence
PAKYEFNYQVEDAPSGLSFGHSEMRDGDFTTGQYNVLLPDGRKQIVEYEADQQGYRPQIRYEGDANDGSGPSGPGGPGGQNLGADGYSSGRPGNGNGNGNGGYSGGRPGGQDLGPSGYSGGRPGGQDLGAGGYSNGKPGGQDLGPGGYSGGRPGGQDLGRDGYSGGRPGGQDLGASGYSNGRPGGNGNGGSDGGRVIIGGRVIGGQDGGDQGYSGGRPGGQDLGRDGYSSGRPGGRPGGNGQDSQDGQGYSSGRPGQGGRNGFGPGGQNGDNDGSGYRY
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
34.9 kDa
Protein Length
Partial
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Drosophila melanogaster Pro-resilin is a research-grade protein expressed in E. coli, featuring a partial sequence from amino acids 342 to 620. This protein contains N-terminal 10xHis and C-terminal Myc tags for streamlined purification and detection. SDS-PAGE analysis confirms the protein achieves over 90% purity, which appears sufficient for most experimental applications where high purity is essential.

Pro-resilin represents a structural protein found in the cuticle of Drosophila melanogaster. What makes it particularly interesting is its exceptional elastic properties. The protein seems to play a crucial role in providing elasticity and resilience to insect tissues—characteristics that are vital for movement and mechanical stability. These unique features have caught the attention of biomaterials researchers, who are studying its mechanical properties for potential applications in new material development.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Based on the provided information, the folding state and bioactivity of this recombinant resilin protein fragment are unknown and must be considered highly uncertain. Resilin is an elastic protein that requires specific post-translational modifications (e.g., di- and trityrosine cross-linking) for its native function, which are unlikely to occur in the reducing cytoplasm of E. coli. The expression of a partial fragment (342-620aa) with large tags on both termini (N-terminal 10xHis and C-terminal Myc) further complicates correct folding, as the tags may sterically hinder the protein's natural conformation. Therefore, it is highly improbable that this protein is correctly folded or bioactive for its native elastic properties. Applications relying on specific biological interactions or the protein's native structure are speculative without validation.

1. Biochemical Characterization of Resilin Protein Properties

This purified recombinant protein is suitable for basic biochemical and biophysical characterization. Techniques like amino acid analysis, circular dichroism, and stability studies can be applied to study this specific fragment. This application is valid as it focuses on the intrinsic properties of the polypeptide, independent of native bioactivity. However, the data will characterize the recombinant fragment rather than the native resilin network, so comparisons with to full-length protein should be made cautiously.

2. Development of Anti-Resilin Research Antibodies

The recombinant resilin protein can be used as an immunogen to generate antibodies. The high purity minimizes cross-reactivity issues. However, the antibodies generated will recognize linear epitopes of this non-cross-linked, bacterially expressed fragment. Their ability to recognize the naturally cross-linked, mature resilin in Drosophila tissues is very low and requires rigorous validation. These antibodies are best suited for detecting denatured resilin in Western blots.

3. Tag-Based ELISA Development for Resilin Detection

The dual tags enable sandwich ELISA development. However, the utility is limited to detecting the recombinant resilin protein itself. The assay will not accurately quantify native resilin in biological samples, as the epitopes may be masked or altered in the cross-linked native form. Such an ELISA is only for research on the recombinant standard, not for endogenous resilin detection.

Final Recommendation & Action Plan

The immediate recommendation is to restrict the use of this protein to applications that do not depend on native folding or bioactivity, such as biochemical characterization (Application 1) and antibody production for linear epitope detection (Application 3). Prior to any functional studies, the protein's folding should be assessed using techniques like circular dichroism or size-exclusion chromatography, and if possible, compared to native resilin.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Plays a central role in insect flight by providing low stiffness, high strain and efficient energy storage.
Gene References into Functions
  1. A reversible beta-turn transition was identified in the peptide encoded by exon III and for full-length resilin during energy input and release. PMID: 22893127
  2. resilin expression has been detected during embryogenesis, revealing segmental patches of resilin in the developing epidermis of Drosophila. PMID: 22275226
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*