Recombinant Endo-beta-N-acetylglucosaminidase H, partial

In Stock
Code CSB-YP356191SPF
Abbreviation Recombinant Endo-beta-N-acetylglucosaminidase H protein, partial
MSDS
Size $436
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
N/A
Uniprot No.
Research Area
Biochemicals
Alternative Names
DI-N-acetylchitobiosyl beta-N-acetylglucosaminidase H Endoglycosidase H Short name: Endo H Mannosyl-glycoprotein endo-beta-N-acetyl-glucosaminidase H
Species
Streptomyces plicatus
Source
Yeast
Expression Region
45-313aa
Target Protein Sequence
APVKQGPTSVAYVEVNNNSMLNVGKYTLADGGGNAFDVAVIFAANINYDTGTKTAYLHFNENVQRVLDNAVTQIRPLQQQGIKVLLSVLGNHQGAGFANFPSQQAASAFAKQLSDAVAKYGLDGVDFDDEYAEYGNNGTAQPNDSSFVHLVTALRANMPDKIISLYNIGPAASRLSYGGVDVSDKFDYAWNPYYGTWQVPGIALPKAQLSPAAVEIGRTSRSTVADLARRTVDEGYGVYLTYNLDGGDRTADVSAFTRELYGSEAVRTP
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
31.2 kDa
Protein Length
Partial
Tag Info
C-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Endo-beta-N-acetylglucosaminidase H from Streptomyces plicatus gets expressed in a yeast system, spanning amino acid region 45-313. This partially expressed protein includes a C-terminal 6xHis-tag, which makes purification and detection straightforward. SDS-PAGE confirms a purity level greater than 90%, suggesting it works well for various research applications that need high-quality reagents.

Endo-beta-N-acetylglucosaminidase H appears to play a critical role in modifying glycoproteins by cleaving N-linked oligosaccharides. The enzyme seems particularly significant when studying glycoprotein biosynthesis and processing. Researchers often turn to this enzyme for analyzing glycoprotein structures and functions, making it a valuable tool in biochemical research and glycomics.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Endo-beta-N-acetylglucosaminidase H (Endo H) is a well-characterized glycosidase that requires precise folding and proper active site formation for its enzymatic activity in cleaving high-mannose and hybrid-type N-glycans. The yeast expression system provides a suitable eukaryotic environment for correct folding and potential glycosylation of this enzyme. The C-terminal 6xHis tag is unlikely to interfere with the catalytic domain and facilitates purification. The partial fragment (45-313aa) likely contains the complete catalytic domain essential for enzymatic function. The probability of correct folding with functional enzymatic activity is high, though experimental validation of deglycosylation activity is recommended.

1. N-linked Glycan Structure Analysis and Deglycosylation Studies

This application is highly suitable. Endo H is widely used for glycan analysis and deglycosylation. The yeast-expressed enzyme with a C-terminal tag is likely fully functional. Validation with standard glycoprotein substrates (e.g., RNase B) is recommended to confirm specific activity before critical experiments.

2. Glycoprotein Mobility Shift Assays and Western Blot Analysis

This application is well-suited for confirming N-glycosylation. The high purity ensures reliable results in mobility shift assays. The enzyme should be tested with control glycoproteins to verify complete deglycosylation capability before analytical use.

3. Preparation of Deglycosylated Protein Standards

This application is suitable but requires optimization. While the enzyme can generate deglycosylated standards, complete removal of the enzyme after reaction is essential to prevent contamination. The His-tag facilitates removal via nickel affinity, but efficiency should be validated.

4. Enzyme Activity and Specificity Studies
This application is highly suitable for biochemical characterization. The recombinant enzyme can be used to determine kinetic parameters (Km, Vmax), pH/temperature optima, and substrate specificity. Comparison with commercial Endo H can validate performance.

Final Recommendation & Action Plan

This yeast-expressed Endo H with C-terminal His-tag is highly suitable for glycosylation analysis applications due to the appropriate expression system and non-interfering tag placement. Begin with validation using standard glycoprotein substrates (e.g., RNase B for high-mannose glycans) to confirm specific deglycosylation activity. Applications 1, 2, and 4 can proceed once basic activity is verified. Application 3 requires additional optimization to ensure complete enzyme removal after deglycosylation. The partial fragment (45-313aa) should be verified to contain the complete catalytic domain for full functionality.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Cleaves asparagine-linked oligomannose and hybrid, but not complex, oligosaccharides from glycoproteins.
Protein Families
Glycosyl hydrolase 18 family
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*