Recombinant Endo-beta-N-acetylglucosaminidase H, partial

In Stock
Code CSB-YP356191SPF
Abbreviation Recombinant Endo-beta-N-acetylglucosaminidase H protein, partial
MSDS
Size $436
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
N/A
Uniprot No.
Research Area
Biochemicals
Alternative Names
DI-N-acetylchitobiosyl beta-N-acetylglucosaminidase H Endoglycosidase H Short name: Endo H Mannosyl-glycoprotein endo-beta-N-acetyl-glucosaminidase H
Species
Streptomyces plicatus
Source
Yeast
Expression Region
45-313aa
Target Protein Sequence
APVKQGPTSVAYVEVNNNSMLNVGKYTLADGGGNAFDVAVIFAANINYDTGTKTAYLHFNENVQRVLDNAVTQIRPLQQQGIKVLLSVLGNHQGAGFANFPSQQAASAFAKQLSDAVAKYGLDGVDFDDEYAEYGNNGTAQPNDSSFVHLVTALRANMPDKIISLYNIGPAASRLSYGGVDVSDKFDYAWNPYYGTWQVPGIALPKAQLSPAAVEIGRTSRSTVADLARRTVDEGYGVYLTYNLDGGDRTADVSAFTRELYGSEAVRTP
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
31.2 kDa
Protein Length
Partial
Tag Info
C-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Endo-beta-N-acetylglucosaminidase H from Streptomyces plicatus gets expressed in a yeast system, spanning amino acid region 45-313. This partially expressed protein includes a C-terminal 6xHis-tag, which makes purification and detection straightforward. SDS-PAGE confirms a purity level greater than 90%, suggesting it works well for various research applications that need high-quality reagents.

Endo-beta-N-acetylglucosaminidase H appears to play a critical role in modifying glycoproteins by cleaving N-linked oligosaccharides. The enzyme seems particularly significant when studying glycoprotein biosynthesis and processing. Researchers often turn to this enzyme for analyzing glycoprotein structures and functions, making it a valuable tool in biochemical research and glycomics.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

1. N-linked Glycan Structure Analysis and Deglycosylation Studies

This recombinant Endo-beta-N-acetylglucosaminidase H works as a research tool for analyzing N-linked glycan structures on glycoproteins through enzymatic deglycosylation. The enzyme specifically cleaves between the two N-acetylglucosamine residues in the chitobiose core of high-mannose and hybrid-type N-glycans. This makes it valuable for glycan structural characterization. The C-terminal 6xHis tag makes purification and immobilization simple for repeated use in glycan analysis workflows. Researchers can apply this enzyme to study glycosylation patterns in various protein samples and compare glycan structures across different expression systems.

2. Glycoprotein Mobility Shift Assays and Western Blot Analysis

The enzyme serves as a useful tool for confirming N-linked glycosylation status of target proteins through SDS-PAGE mobility shift assays. When researchers treat glycoproteins with this endoglycosidase, they'll likely see characteristic changes in electrophoretic mobility. This allows them to distinguish between glycosylated and non-glycosylated forms. The high purity (>90%) appears to ensure reliable and reproducible results in these analytical applications. This approach proves particularly useful for validating glycosylation sites and studying how glycosylation affects protein migration patterns.

3. Preparation of Deglycosylated Protein Standards

This recombinant enzyme can generate deglycosylated protein standards for comparative studies in protein biochemistry research. Controlled removal of N-linked glycans allows researchers to study how glycosylation impacts protein properties such as stability, folding, and interactions. The 6xHis tag enables easy removal of the enzyme from reaction mixtures using metal affinity chromatography. This ensures clean preparation of deglycosylated protein products. Such standards prove valuable for mass spectrometry analysis and structural studies where glycan heterogeneity needs reduction.

4. Enzyme Activity and Specificity Studies

The recombinant protein can serve as a subject for detailed biochemical characterization studies to understand endoglycosidase mechanisms and substrate specificity. Researchers may investigate optimal reaction conditions, pH and temperature profiles, and kinetic parameters using various glycoprotein substrates. The yeast expression system might provide proper protein folding, while the His-tag makes purification for activity assays more manageable. These studies contribute to fundamental understanding of glycan-processing enzymes and their potential applications in glycobiology research.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Cleaves asparagine-linked oligomannose and hybrid, but not complex, oligosaccharides from glycoproteins.
Protein Families
Glycosyl hydrolase 18 family
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*