Recombinant Epstein-Barr virus Epstein-Barr nuclear antigen 2 (EBNA2), partial

In Stock
Code CSB-YP718162EEZ(A4)
Abbreviation Recombinant Epstein-Barr virus EBNA2 protein, partial
MSDS
Size $436
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
EBNA2
Uniprot No.
Alternative Names
EBNA2; BYRF1Epstein-Barr nuclear antigen 2; EBNA-2; EBV nuclear antigen 2
Species
Epstein-Barr virus (strain AG876) (HHV-4) (Human herpesvirus 4)
Source
Yeast
Expression Region
247-454aa
Target Protein Sequence
SYSIPSMTLSPEPLPPPAAPAHPLPGVIYDQQALPPTPGPPWWPPVRDPTPTTQTPPTNTKQGPDQGQGRGRWRGRGRSKGRGRMHKLPEPRRPGPDTSSPSMPQLSPVVSLHQGQGPENSPTPGPSTAGPVCRVTPSATPDISPIHEPESSDSEEPPFLFPSDWYPPTLEPAELDESWEGIFETTESHSSDEENVGGPSKRPRTSTQ
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
25.9kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The expression region of this recombinant Epstein-Barr virus EBNA2 covers amino acids 247-454. The expected molecular weight for the EBNA2 protein is calculated to be 25.9 kDa. This EBNA2 recombinant protein is manufactured in yeast. The EBNA2 gene fragment has been modified by fusing the N-terminal 6xHis tag and C-terminal Myc tag, providing convenience in detecting and purifying the recombinant EBNA2 protein during the following stages.

Epstein-Barr virus Epstein-Barr nuclear antigen 2 (EBNA2) is a transcriptional activator that plays a crucial role in initiating and maintaining the viral latent infection. It regulates the expression of both viral and cellular genes, promoting the survival and proliferation of infected B cells. EBNA2 interacts with host cell transcription factors, including the cellular DNA-binding protein RBP-Jκ, leading to the activation of viral latent genes, thus contributing to the establishment of latent infection. EBNA2 is essential for the transformation of primary B cells into immortalized lymphoblastoid cell lines (LCLs). This process is a hallmark of EBV-associated B-cell malignancies. EBNA2 can modulate various cellular signaling pathways, including the Notch signaling pathway, to create a favorable environment for viral persistence and cell survival. EBNA2's role in cellular transformation is linked to the development of EBV-associated cancers, such as Burkitt's lymphoma, Hodgkin's lymphoma, and nasopharyngeal carcinoma.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Plays a key role in the activation of the host resting B-cell and stimulation of B-cell proliferation. Acts by up-regulating the expression of viral EBNA1-6, LMP1, LMP2A and LMP2B genes, as well as several host genes including CD21, CD23 and MYC. Activates transcription by acting as an adapter molecule that binds to cellular sequence-specific DNA-binding proteins such as host CBF1, SMARCB1 and SPI1. Once EBNA2 is near promoter sites, its acidic activating domain recruits basal and activation-associated transcription factors TFIIB, TAF40, TFIIH components ERCC2 and ERCC3, and CBP in order to promote transcription. Alternatively, EBNA2 can affect activities of cell cycle regulators and retard cell cycle progression at G2/M phase. It also induces chromosomal instability, by disrupting mitotic checkpoints, multi-nucleation and formation of micronuclei in infected cells.
Subcellular Location
Host nucleus matrix.
Protein Families
Herpesviridae EBNA2 family
Database Links

KEGG: vg:5176198

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*