Recombinant Epstein-Barr virus Glycoprotein 42 (BZLF2), partial

In Stock
Code CSB-EP313729EFCc7
Abbreviation Recombinant Epstein-Barr virus BZLF2 protein, partial
MSDS
Size $388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Activity
Not Test
Target Names
BZLF2
Uniprot No.
Research Area
Others
Alternative Names
gp42
Species
Epstein-Barr virus (strain GD1) (HHV-4) (Human herpesvirus 4)
Source
E.coli
Expression Region
34-223aa
Target Protein Sequence
GGRVAAAAITWVPKPNVEVWPVDPPPPVNFNKTAEQEYGDKEVKLPHWTPTLHTFQVPQNYTKANCTYCNTREYTFSYKGCCFYFTKKKHTWNGCFQACAELYPCTYFYGPTPDILPVVTRNLNAIESLWVGVYRVGEGNWTSLDGGTFKVYQIFGSHCTYVSKFSTVPVSHHECSFLKPCLCVSQRSNS
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
28.5 kDa
Protein Length
Partial
Tag Info
C-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Datasheet & COA
Please contact us to get it.
Description

Recombinant Epstein-Barr virus Glycoprotein 42 (BZLF2) is expressed in E. coli, spanning amino acids 34 to 223 of the viral protein. This partial protein carries a C-terminal 6xHis tag and reaches a purity level of over 90% as confirmed by SDS-PAGE analysis. The protein is designed for research use only, though it appears to offer a dependable option for researchers investigating viral proteins and their interactions.

Glycoprotein 42 (gp42) of the Epstein-Barr virus seems to play a crucial role in the virus's ability to infect host cells. The protein is involved in the fusion process, helping the virus enter the host by interacting with cellular receptors. Understanding gp42's function may be essential for studying viral entry mechanisms and pathogenesis, which likely makes it a significant focus in virology research.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

The recombinant EBV glycoprotein 42 (a viral glycoprotein) is expressed in E. coli, a prokaryotic system that lacks the machinery for eukaryotic-type post-translational modifications, such as glycosylation. Glycoprotein 42 is naturally glycosylated in viral contexts, and glycosylation is often critical for correct folding, stability, and biological activity (e.g., receptor binding). The protein is expressed as a partial fragment (34-223aa), which may not include full structural domains required for native conformation. Since activity is unverified, the protein is likely misfolded or inactive due to the absence of glycosylation and potential improper folding in E. coli. Therefore, it cannot be assumed to be correctly folded or bioactive without experimental validation.

1. Antibody Development and Characterization

This recombinant EBV glycoprotein 42 fragment can work as an immunogen for generating antibodies, but if misfolded (which is probable due to lack of glycosylation), the antibodies may primarily recognize linear epitopes and might not bind the native, glycosylated form of the protein in viral contexts. The His tag aids purification, and >90% purity is sufficient for immunization. However, antibodies should be validated against native glycoprotein 42 from EBV-infected cells to ensure relevance to physiological conditions.

2. Protein-Protein Interaction Studies

The use of this recombinant glycoprotein 42 in pull-down assays is high-risk. If the protein is misfolded (as expected due to expression in E. coli), it may not interact authentically with host receptors or viral partners, leading to false positives or negatives. The His tag allows immobilization, but the results would be unreliable for studying pathogenesis without folding validation. This application should be avoided unless correct folding is confirmed.

3. ELISA-Based Binding Assays

This application is problematic if the assay depends on conformational epitopes. The recombinant protein can be coated on plates, but if misfolded, binding studies with receptors (e.g., MHC class II) may not reflect native interactions. The high purity improves coating efficiency, but data should be interpreted cautiously. If used for linear epitope mapping, it might work, but for conformational studies, it is not recommended without folding checks.

4. Western Blot Standard and Positive Control

This application is suitable because Western blotting operates under denaturing conditions, where protein folding is irrelevant. The recombinant protein can serve as a positive control for size reference and antibody validation against the linear sequence. The partial fragment (34-223aa) and His tag provide a defined standard, and high purity ensures reliability.

Final Recommendation & Action Plan

Given the high likelihood of misfolding due to E. coli expression lacking glycosylation, it is essential to validate protein folding before any bioactive applications. Recommend first performing biophysical analyses (e.g., circular dichroism for secondary structure, size-exclusion chromatography for oligomeric state) to assess folding. If misfolding is confirmed, prioritize applications like antibody development (for linear epitopes) and Western blot standards, while avoiding interaction or binding studies. For functional insights, consider alternative expression systems (e.g., mammalian cells) that support glycosylation. Always include controls comparing with the native protein when possible.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Plays a role in virion attachment to host B-lymphocytes, through binding to leukocyte antigen (HLA) class II and subsequently participates in fusion of the virion with host membranes. May act as a tropism switch that directs fusion with B-lymphocytes and inhibits fusion with epithelial cells.
Subcellular Location
Virion membrane.
Protein Families
Epstein barr virus gp42 family
Database Links

KEGG: vg:3783745

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*