Recombinant Epstein-Barr virus Latent membrane protein 2 (LMP2), partial

In Stock
Code CSB-EP321086EFA
Abbreviation Recombinant Epstein-Barr virus LMP2 protein, partial
MSDS
Size US$388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
LMP2
Uniprot No.
Research Area
Cell Biology
Alternative Names
LMP2; Latent membrane protein 2; Terminal protein
Species
Epstein-Barr virus
Source
E.coli
Expression Region
1-147aa
Target Protein Sequence
MGSLEMVPMGAGPPSPGGDPDGYDGGNNSQYPSASGSSGNTPTPPNDEERESNEEPPPPYEDPYWGNGDRHSDYQPLGTQDQSLYLGLQHDGNDGLPPPPYSPRDDSSQHIYEEAGRGSMNPVCLPVIVAPYLFWLAAIAASCFTAS
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
31.6kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

 Q&A
Q:

Regarding your protein CSB-EP321086EFA, can you please advise on the lead time, the sequencing, the pricing, and the expected tag information?
Also, do you have the full-length version of this protein available?
Thanks!

A:
Thanks for your inquiry.
Expression Region: 1-147aa; Partial.
Tag information:N-terminal 6xHis-SUMO-tagged.
Sequence:

MGSLEMVPMGAGPPSPGGDPDGYDGGNNSQYPSASGSSGNTPTPPNDEERESNEEPPPPYEDPYWGNGDRHSDYQPLGTQDQSLYLGLQHDGNDGLPPPPYSPRDDSSQHIYEEAGRGSMNPVCLPVIVAPYLFWLAAIAASCFTAS


② The full length of this protein has 497aa and it's a transmembrane protein with 12 times transmembrane domains, we can provide risk-free custom service if you need the full length protein.
Recombinant Epstein-Barr virus Latent membrane protein 2(LMP2)
CSB-CF321086EFA(A4)
Expression Region: 1-497aa; Full length.
Tag information: Tag type will be determined during the manufacturing process.
We can try to express your desired tag first if you have special request for the tag, but as we can't guarantee, if it's failed, we can provide protein with other tag.
Sequence:

MGSLEMVPMGAGPPSPGGDPDGYDGGNNSQYPSASGSSGNTPTPPNDEERESNEEPPPPYEDPYWGNGDRHSDYQPLGTQDQSLYLGLQHDGNDGLPPPPYSPRDDSSQHIYEEAGRGSMNPVCLPVIVAPYLFWLAAIAASCFTASVSTVVTATGLALSLLLLAAVASSYAAAQRKLLTPVTVLTAVVTFFAICLTWRIEDPPFNSLLFALLAAAGGLQGIYVLVMLVLLILAYRRRWRRLTVCGGIMFLACVLVLIVDAVLQLSPLLGAVTVVSMTLLLLAFVLWLSSPGGLGTLGAALLTLAAALALLASLILGTLNLTTMFLLMLLWTLVVLLICSSCSSCPLSKILLARLFLYALALLLLASALIAGGSILQTNFKSLSSTEFIPNLFCMLLLIVAGILFILAILTEWGSGNRTYGPVFMCLGGLLTMVAGAVWLTVMSNTLLSAWILTAGFLIFLIGFALFGVIRCCRYCCYYCLTLESEERPPTPYRNTV


Reference: https://www.uniprot.org/uniprot/P13285
If we can successfully express this protein, you could pay the corresponding fees and we will provide the purified protein.
If we are failed in expression this protein, you don't need to pay any fees. However you could pay for the gene synthesis and subcloning to purchase the constructed plasmid and strains if you need.
PS: The expression plasmid is not for sale if this project is successful.

Target Background

Function
Isoform LMP2A maintains EBV latent infection of B-lymphocyte, by preventing lytic reactivation of the virus in response to surface immunoglobulin (sIg) cross-linking. Acts like a dominant negative inhibitor of the sIg-associated protein tyrosine kinases, LYN and SYK. Also blocks translocation of the B-cell antigen receptor (BCR) into lipid rafts, preventing the subsequent signaling and accelerated internalization of the BCR upon BCR cross-linking. Serves as a molecular scaffold to recruit SYK, LYN and E3 protein-ubiquitin ligases, such as ITCH and NEDD4L, leading to ubiquitination and potential degradation of both tyrosines kinases. Possesses a constitutive signaling activity in non-transformed cells, inducing bypass of normal B lymphocyte developmental checkpoints allowing immunoglobulin-negative cells to colonize peripheral lymphoid organs.; Isoform LMP2B may be a negative regulator of isoform LMP2A.
Gene References into Functions
  1. In EBV-positive Hodgkin's lymphoma LMP2A-expressing HRS cells lacking BCR signalling functions cannot induce EGR1 and are consequently protected from entry to the virus lytic cycle. PMID: 23592216
  2. Epstein-Barr virus latent membrane protein 2A contributes to anoikis resistance through ERK activation. PMID: 23698301
  3. LMP2A, but not LMP2B, is critical for efficient long-term growth of B cells in vitro. PMID: 23308294
  4. LMP2A plays a role in the alteration of a cytokine that is important for both tumour survival and anti-tumour responses. PMID: 23303827
  5. LMP2A can affect a number of signaling pathways by regulating the phosphorylation of the ITSN1 and Shb adaptors. PMID: 22975684
  6. Data show that LMP2A enhances antigen presentation function. PMID: 22616025
  7. hnRNP K, when co-expressed with EBNA2, strongly enhances viral latent membrane protein 2A (LMP2A) expression. PMID: 22879910
  8. Epstein-Barr virus latent membrane protein-2A induces ITAM/Syk- and Akt-dependent epithelial migration through alphav-integrin membrane translocation PMID: 22837212
  9. Fra-1 was induced by Epstein-Barr virus LMP2A and is essential for LMP2A-triggered MMP9 expression. PMID: 22514348
  10. Widespread sequence variations in the LMP2A gene were found PMID: 22470549
  11. Studies suggest that LMP2A can also participate in EBV-induced epithelial cell growth transformation. PMID: 22249143
  12. EBV LMP2A is expressed in nasopharyngeal cancer. Cases with nasopharyngeal inflammation showed negative expression of LMP2A. PMID: 16124641
  13. Results confirmed that HPV L1 protein is potential to deliver multiepitope of EBV LMP2 as immunogen. PMID: 20705592
  14. LMP2A induces an epithelial-mesenchymal transition and increases the number of side population stem-like cancer cells in nasopharyngeal carcinoma. PMID: 20532215
  15. LMP2A uniquely makes resting B-cells sensitive to NF-kappaB inhibition and apoptosis and suggest that NF-kappaB may be a novel target to eradicate latently EBV-infected B-cells. PMID: 20484564
  16. LMP2A induces a heightened sensitivity to TLR ligand stimulation PMID: 16920914
  17. Expression of the EBV genes for latent membrane protein 1 and latent membrane protein 2A decreases FoxO1 expression.[LMP-2A] PMID: 16943287
  18. Phosphorylation of LMP2A is prevented by LMP2B. PMID: 17035319
  19. results indicate that cholesterol-dependent LMP2A trafficking determines the fate of LMP2A degradation PMID: 17150237
  20. The signalling scaffold Shb associates through SH2 and PTB domain interactions with phosphorylated tyrosine motifs in the LMP2A N-terminal tail. PMID: 17311000
  21. These results suggest that constitutive activation of the Ras/PI3-K/Akt pathway by LMP2A is a key factor for LMP2A-mediated transformation. PMID: 17582000
  22. All isolates from 7 Japanese nasal NK/T cell lymphomas showed the same amino acid change from serine to threonine at codon 348 in the CTL epitope SSCSSCPLSK of LMP2A. PMID: 17657160
  23. A role for LMP2A as an indispensable BCR mimic in certain B cells from which human B-cell tumors such as Hodgkin lymphoma originate. PMID: 17682125
  24. The results suggest that the combinatorial effects of DNA methylation, histone acetylation, and H3K4me2 modulate the activity of LMP2A promoter. PMID: 17898065
  25. These results demonstrate that LMP2A activates the Notch pathway in both B cells and epithelial cells, and exploits this pathway to regulate its own expresison. PMID: 17980397
  26. EBV uses its latent protein, LMP2A, to activate the NF-kappaB-survivin pathway to rescue EBV-infected epithelial cells from serum deprivation PMID: 18316606
  27. Despite the lack of pre-BCR expression, bone marrow B cells from TgE LMP2A mice proliferate and survive in low concentrations of interleukin 7, similar to wild-type cells. PMID: 18559925
  28. This demonstrates that the UGDH transcript and protein quantities, the enzyme activity, and glycosaminoglycan contents increase in LMP2A overexpressed human embryonic kidney 293 (HEK293) cells. PMID: 18717819
  29. LMP2A and the Notch1 pathway may cooperate to induce the alterations in B-cell identity seen in Hodgkin Reed-Sternberg cells PMID: 18815281
  30. LMP2B modulates the activity of LMP2A contributing to maintenance of Epstein-Barr virus latency. PMID: 18835714
  31. the immunoreceptor tyrosine-based activation motif (ITAM) of LMP-2A is important for HERV-K18 env transactivation PMID: 19070345
  32. c-Cbl promoted LMP2A degradation through ubiquitination, specifically degraded the Syk protein tyrosine kinase in the presence of LMP2A, and inhibited LMP2A induction of the EBV lytic cycle PMID: 19081591
  33. EBV LMP2A promotes tumor development by protecting pre-tumor B cells that would normally apoptose after the c-myc translocation. PMID: 19182823
  34. LMP2A can permit tumorigenesis in the presence of an intact p53 pathway, identifying an important contribution of EBV to Burkitt's lymphoma PMID: 19815507
  35. Our findings emphasize the role of miR-BART22 in modulating LMP2A expression PMID: 19881953

Show More

Hide All

Subcellular Location
[Isoform LMP2A]: Host cell membrane; Multi-pass membrane protein.; [Isoform LMP2B]: Host endomembrane system; Multi-pass membrane protein. Host cytoplasm, host perinuclear region.
Protein Families
Herpesviridae LMP-2 family
Database Links

KEGG: vg:3783751

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*