Recombinant Epstein-Barr virus Secreted protein BARF1 (BARF1)

In Stock
Code CSB-EP317825EFC
Abbreviation Recombinant Epstein-Barr virus BARF1 protein
MSDS
Size $388
Order now
Image
  • Warning: preg_replace(): Unknown modifier 'a' in /www/wwwroot/cusabio.com/caches/caches_template/20141113/content/show_product_protein.php on line 156
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
BARF1
Uniprot No.
Research Area
Cancer
Alternative Names
33 kDa early protein p33
Species
Epstein-Barr virus (strain GD1) (HHV-4) (Human herpesvirus 4)
Source
E.coli
Expression Region
21-221aa
Target Protein Sequence
VTAFLGERVTLTSYWRRVSLGPEIEVSWFKLGPGEEQVLIGRMHHDVIFIEWPFRGFFDIHRSANTFFLVVTAANISHDGNYLCRMKLGETEVTKQEHLSVVKPLTLSVHSERSQFPDFSVLTVTCTVNAFPHPHVQWLMPEGVEPAPTAANGGVMKEKDGSLSVAVDLSLPKPWHLPVTCVGKNDKEEAHGVYVSGYLSQ
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
28.4 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The process of synthesizing recombinant Epstein-Barr virus Secreted protein BARF1 begins with isolating the target gene. This gene encoding the HHV-4 BARF1 (21-221aa) is fused with an N-terminal 6xHis-tag gene and then cloned into an expression vector, which is transformed into E. coli cells. The positive E. coli cells express the recombinant BARF1 protein in the culture medium and are lysed to release these proteins. The collected protein is purified using affinity chromatography. Its purity is greater than 90% as determined by SDS-PAGE.

Epstein-Barr virus (EBV) secreted protein BARF1 is a viral oncoprotein crucial for EBV-associated malignancies. BARF1 has pleiotropic functions, contributing to cell growth, survival, and immune modulation [1]. It is selectively expressed in latently infected epithelial cancers such as nasopharyngeal carcinoma (NPC) and EBV-positive gastric cancer (EBV-GC) [2]. Despite being an early lytic gene, BARF1 is expressed during epithelial EBV latency, mainly as a secreted protein [3]. BARF1 functions by up-regulating anti-apoptotic Bcl-2 and stimulating host cell growth and survival [4]. BARF1 neutralizes hematopoietic colony-stimulating factor 1 (hCSF-1) to achieve immunomodulation [5]. It has been identified as a decoy receptor for macrophage colony-stimulating factors, interfering with macrophage differentiation and activation [6].

References:
[1] E. Hoebe, T. Large, A. Greijer, & J. Middeldorp, Bamhi‐a rightward frame 1, an epstein–barr virus‐encoded oncogene and immune modulator, Reviews in Medical Virology, vol. 23, no. 6, p. 367-383, 2013. https://doi.org/10.1002/rmv.1758
[2] A. Lo, C. Dawson, H. Lung, K. Wong, & Y. Lw, The therapeutic potential of targeting barf1 in ebv-associated malignancies, Cancers, vol. 12, no. 7, p. 1940, 2020. https://doi.org/10.3390/cancers12071940
[3] R. Blanco and F. Aguayo, Role of bamhi-a rightward frame 1 in epstein–barr virus-associated epithelial malignancies, Biology, vol. 9, no. 12, p. 461, 2020. https://doi.org/10.3390/biology9120461
[4] E. Seto, L. Yang, J. Middeldorp, T. Sheen, J. Chen, M. Fukayamaet al., Epstein-barr virus (ebv)-encodedbarf1 gene is expressed in nasopharyngeal carcinoma and ebv-associated gastric carcinoma tissues in the absence of lytic gene expression, Journal of Medical Virology, vol. 76, no. 1, p. 82-88, 2005. https://doi.org/10.1002/jmv.20327
[5] J. Elegheert, N. Bracke, P. Pouliot, I. Gutsche, A. Shkumatov, N. Tarbouriechet al., Allosteric competitive inactivation of hematopoietic csf-1 signaling by the viral decoy receptor barf1, Nature Structural & Molecular Biology, vol. 19, no. 9, p. 938-947, 2012. https://doi.org/10.1038/nsmb.2367
[6] E. Hoebe, T. Large, N. Tarbouriech, D. Oosterhoff, T. Gruijl, J. Middeldorpet al., Epstein-barr virus-encoded barf1 protein is a decoy receptor for macrophage colony stimulating factor and interferes with macrophage differentiation and activation, Viral Immunology, vol. 25, no. 6, p. 461-470, 2012. https://doi.org/10.1089/vim.2012.0034

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Plays diverse functions in immunomodulation and oncogenicity, maybe by acting as a functional receptor for human CSF1. May inhibit interferon secretion from mononuclear cells. Exhibits oncogenic activity in vitro.
Gene References into Functions
  1. Epstein Barr virus-encoded BARF1 promotes cell proliferation in stomach cancer by upregulating NFkappaB and miR-146a and downregulating SMAD4, thereby contributing to EBV-induced stomach cancer progression. PMID: 27438138
  2. siRNA-mediated BARF1 down-regulation induces caspase-dependent apoptosis via the mitochondrial pathway through modulation of Bcl-2/BAX ratio in AG876 and Hone-Akata cells. PMID: 25740140
  3. In BARF1-transfected cells, cell growth was activated and its protein was found both in culture medium and cellular compartment (membrane, cytoplasm and nuclei). PMID: 23458996
  4. These results indicate that BARF1 blockade of CSF-1 signaling is an important immune evasion strategy for efficient acute EBV infection and a significant determinant for virus setpoint during persistent EBV infection. PMID: 23300447
  5. M-CSF was shown to interact with Epstein-Barr virus-encoded BARF1 via the protruding N-terminal loops involving Val38 and Ala84. PMID: 23061794
  6. Studies indicate that BARF1 is expressed as a latent gene in nasopharyngeal carcinoma (NPC), and that BARF1 contributes to the tumorigenicity of NPC cells. PMID: 22210180
  7. The N- and O-glycans were partially characterized and it was demonstrated that both modifications are required for active secretion of the BARF1 protein via the classical pathway. PMID: 17872516

Show More

Hide All

Subcellular Location
Secreted.
Database Links

KEGG: vg:3783772

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*