Purity
Greater than 90% as determined by SDS-PAGE.
Species
Epstein-Barr virus (strain GD1) (HHV-4) (Human herpesvirus 4)
Expression Region
21-221aa
Target Protein Sequence
VTAFLGERVTLTSYWRRVSLGPEIEVSWFKLGPGEEQVLIGRMHHDVIFIEWPFRGFFDIHRSANTFFLVVTAANISHDGNYLCRMKLGETEVTKQEHLSVVKPLTLSVHSERSQFPDFSVLTVTCTVNAFPHPHVQWLMPEGVEPAPTAANGGVMKEKDGSLSVAVDLSLPKPWHLPVTCVGKNDKEEAHGVYVSGYLSQ
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
Amino acids 21-221 constitute the expression domain of recombinant Epstein-Barr virus BARF1. The expected molecular weight for the BARF1 protein is calculated to be 28.4 kDa. The BARF1 protein was expressed in e.coli. The BARF1 gene fragment has been modified by fusing the N-terminal 6xHis tag, providing convenience in detecting and purifying the recombinant BARF1 protein during the following stages.
Epstein-Barr virus secreted protein BARF1 is a viral protein expressed during the lytic phase of the Epstein-Barr virus (EBV) life cycle. BARF1 is notable for its secretion into the extracellular environment. It possesses immunomodulatory properties, contributing to the virus's evasion of host immune responses. BARF1 has been shown to interact with various components of the immune system, including inhibition of major histocompatibility complex (MHC) class I antigen presentation and interference with cytokine signaling pathways. Research on BARF1 aims to unravel its specific mechanisms of immune evasion and its potential role in EBV-associated diseases, such as nasopharyngeal carcinoma and EBV-associated gastric carcinoma. Understanding BARF1's functions is crucial for developing strategies to counteract viral immune evasion and improve therapeutic interventions.
