Recombinant Escherichia coli Acidic protein msyB (msyB)

In Stock
Code CSB-BP340725ENV
Abbreviation Recombinant E.coli msyB protein
MSDS
Size $528
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
msyB
Uniprot No.
Research Area
others
Alternative Names
msyB; b1051; JW1039; Acidic protein MsyB
Species
Escherichia coli (strain K12)
Source
Baculovirus
Expression Region
1-124aa
Target Protein Sequence
MTMYATLEEAIDAAREEFLADNPGIDAEDANVQQFNAQKYVLQDGDIMWQVEFFADEGEEGECLPMLSGEAAQSVFDGDYDEIEIRQEWQEENTLHEWDEGEFQLEPPLDTEEGRAAADEWDER
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
16.3 kDa
Protein Length
Full Length
Tag Info
C-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Escherichia coli Acidic protein msyB is produced through a baculovirus expression system, which includes the complete protein sequence from amino acids 1 to 124. A C-terminal 6xHis-tag has been added to make purification and detection more straightforward. SDS-PAGE analysis suggests the product achieves purity levels above 85%, making it well-suited for research applications that demand high-quality recombinant proteins.

The msyB protein from Escherichia coli appears to participate in several cellular processes. This makes it a useful tool for investigating bacterial physiology and molecular mechanisms. Research indicates it may be particularly important for understanding how protein interactions work and how cells respond in prokaryotic systems. Scientists are also exploring its role in bacterial regulatory pathways and possible biotechnology uses.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

While the baculovirus expression system generally promotes proper eukaryotic protein folding, its ability to correctly fold a bacterial protein like E. coli msyB is uncertain. The eukaryotic folding environment may lack specific chaperones or conditions optimal for this prokaryotic protein's native conformation. Therefore, the probability of correct folding is moderate but not guaranteed. Consequently, the protein's functional activity remains unknown and cannot be assumed without experimental validation.

1. Protein-Protein Interaction Studies Using His-Tag Pull-Down Assays

The utility of this recombinant msyB for interaction studies is critically dependent on correct folding. If natively folded, it could identify physiological binding partners. However, if misfolded, it may expose non-native hydrophobic surfaces, leading to non-specific (false-positive) binding, or mask the genuine interaction interface, causing false-negative results. Data would be uninterpretable without independent confirmation of its native structure.

2. Antibody Development and Validation

This recombinant msyB serves as an excellent immunogen for generating specific antibodies. The full-length sequence ensures broad epitope coverage. Even if misfolded, it will generate antibodies against linear epitopes useful for techniques like Western blotting. The dual tags simplify purification and screening. If correctly folded, it may also elicit antibodies recognizing conformational epitopes present on the native protein in E. coli.

3. Biochemical Characterization and Stability Studies

This application is the essential first step to determine the protein's physical state. Techniques like size-exclusion chromatography (SEC) can assess oligomeric state and homogeneity, while circular dichroism (CD) can analyze secondary structure content and thermal stability. These studies provide critical data to answer the question of whether the protein is correctly folded and monodisperse. The outcomes directly determine the suitability for any functional application (like Application 1).

4. Comparative Proteomics and Mass Spectrometry Analysis

This recombinant msyB protein is ideal as a quantitative standard for mass spectrometry. Its defined sequence and purity allow it to be used to generate standard curves for absolute quantification (e.g., using AQUA peptides) or to optimize LC-MS/MS parameters for detecting endogenous msyB in complex E. coli lysates.

Final Recommendation & Action Plan

The unknown folding state mandates a sequential, risk-averse approach. The immediate and mandatory first step is to prioritize Application 3 (Biochemical Characterization) to assess the protein's folding integrity and homogeneity via SEC and CD. If it is well-folded and monodisperse, it may then be considered for Application 1 (Interaction Studies), though a positive control interaction should be tested to confirm functional competence. Regardless of the folding results, Applications 2 and 4 (Antibody Development and Mass Spectrometry) can proceed immediately and confidently, as they do not require a natively folded structure. Investing in interaction studies before biophysical validation is a high-risk strategy likely to yield uninterpretable results.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Could participate in the normal pathway of protein export.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*