Recombinant Escherichia coli Acidic protein msyB (msyB)

In Stock
Code CSB-BP340725ENV
Abbreviation Recombinant E.coli msyB protein
MSDS
Size $528
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
msyB
Uniprot No.
Research Area
others
Alternative Names
msyB; b1051; JW1039; Acidic protein MsyB
Species
Escherichia coli (strain K12)
Source
Baculovirus
Expression Region
1-124aa
Target Protein Sequence
MTMYATLEEAIDAAREEFLADNPGIDAEDANVQQFNAQKYVLQDGDIMWQVEFFADEGEEGECLPMLSGEAAQSVFDGDYDEIEIRQEWQEENTLHEWDEGEFQLEPPLDTEEGRAAADEWDER
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
16.3 kDa
Protein Length
Full Length
Tag Info
C-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Escherichia coli Acidic protein msyB is produced through a baculovirus expression system, which includes the complete protein sequence from amino acids 1 to 124. A C-terminal 6xHis-tag has been added to make purification and detection more straightforward. SDS-PAGE analysis suggests the product achieves purity levels above 85%, making it well-suited for research applications that demand high-quality recombinant proteins.

The msyB protein from Escherichia coli appears to participate in several cellular processes. This makes it a useful tool for investigating bacterial physiology and molecular mechanisms. Research indicates it may be particularly important for understanding how protein interactions work and how cells respond in prokaryotic systems. Scientists are also exploring its role in bacterial regulatory pathways and possible biotechnology uses.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

1. Protein-Protein Interaction Studies Using His-Tag Pull-Down Assays

The C-terminal 6xHis-tag attached to this recombinant msyB protein allows researchers to run nickel-affinity chromatography-based pull-down experiments. This helps identify potential binding partners. Scientists can attach the protein to nickel-coated beads or columns, then mix it with E. coli cell lysates or purified protein libraries to catch any interacting proteins. This method seems particularly useful for studying the molecular networks that msyB participates in within E. coli strain K12. The 85% purity level should be adequate for pull-down experiments, where researchers can distinguish the His-tagged target protein from other contaminants.

2. Antibody Development and Validation

This recombinant msyB protein works well as an immunogen for creating polyclonal or monoclonal antibodies that specifically recognize the msyB protein. Since it covers the full-length expression region (1-124aa), it provides broad epitope coverage for antibody recognition. The purified protein also serves as a positive control in antibody validation experiments like Western blotting, ELISA, or immunoprecipitation assays. The C-terminal His-tag makes detection and measurement easier during antibody screening and characterization work.

3. Biochemical Characterization and Stability Studies

Researchers can use the recombinant msyB protein for basic biochemical characterization. This includes determining molecular weight, isoelectric point, and thermal stability profiles. Differential scanning calorimetry and dynamic light scattering experiments may reveal important details about protein folding and how it behaves under different buffer conditions. The baculovirus expression system generally produces properly folded proteins, which makes this protein a good candidate for studying its natural biochemical properties. These studies can establish baseline measurements for more detailed functional research.

4. Comparative Proteomics and Mass Spectrometry Analysis

This purified msyB protein acts as an authentic standard for mass spectrometry-based proteomics studies that examine E. coli protein expression patterns. Scientists can use it to fine-tune LC-MS/MS parameters and test peptide identification algorithms specifically designed for msyB. When comparing proteomics data from E. coli grown under different conditions or with genetic changes, this recombinant protein provides a reliable reference standard for accurate measurement and identification of natural msyB levels.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Could participate in the normal pathway of protein export.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*