Recombinant Escherichia coli Alpha-ketoglutarate-dependent dioxygenase AlkB (alkB)

In Stock
Code CSB-EP356444ENV
Abbreviation Recombinant E.coli alkB protein
MSDS
Size US$388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP356444ENV could indicate that this peptide derived from E.coli-expressed Escherichia coli (strain K12) alkB.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP356444ENV could indicate that this peptide derived from E.coli-expressed Escherichia coli (strain K12) alkB.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
alkB
Uniprot No.
Research Area
Epigenetics and Nuclear Signaling
Alternative Names
alkB; aidD; b2212; JW2200Alpha-ketoglutarate-dependent dioxygenase AlkB; EC 1.14.11.33; Alkylated DNA repair protein AlkB; DNA oxidative demethylase AlkB
Species
Escherichia coli (strain K12)
Source
E.coli
Expression Region
1-216aa
Target Protein Sequence
MLDLFADAEPWQEPLAAGAVILRRFAFNAAEQLIRDINDVASQSPFRQMVTPGGYTMSVAMTNCGHLGWTTHRQGYLYSPIDPQTNKPWPAMPQSFHNLCQRAATAAGYPDFQPDACLINRYAPGAKLSLHQDKDEPDLRAPIVSVSLGLPAIFQFGGLKRNDPLKRLLLEHGDVVVWGGESRLFYHGIQPLKAGFHPLTIDCRYNLTFRQAGKKE
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
44.1kDa
Protein Length
Full Length
Tag Info
N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Escherichia coli Alpha-ketoglutarate-dependent dioxygenase AlkB gets produced in E. coli expression systems and carries both an N-terminal 10xHis-SUMO tag and a C-terminal Myc tag. The protein spans its complete length, covering amino acids 1 to 216, and reaches a purity level greater than 90% as determined by SDS-PAGE. This high-quality preparation is meant for research use only.

E. coli's Alpha-ketoglutarate-dependent dioxygenase AlkB appears to play a key role in repairing alkylated nucleic acids—a process that seems critical for maintaining genetic stability. The enzyme catalyzes the oxidative demethylation of alkylated bases, which essentially reverses damage caused by environmental and endogenous alkylating agents. Studying this enzyme may offer important insights into bacterial DNA repair mechanisms and could shed light on broader molecular pathways involved in cellular maintenance and repair.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Based on the provided information, the recombinant E. coli AlkB protein is expressed in its native E. coli system, which significantly increases the probability of proper folding and functionality. As a bacterial enzyme expressed in its homologous prokaryotic system, AlkB has a high likelihood of correct folding since E. coli contains the necessary cellular machinery for its own proteins. The protein is full-length (1-216aa) with dual tags (N-terminal 10xHis-SUMO and C-terminal Myc) and exhibits high purity (>90%). The SUMO tag may enhance solubility and proper folding. However, since activity is explicitly unverified and the presence of dual tags may potentially interfere with the active site or substrate access, the protein cannot be assumed to be fully functional without experimental validation of its dioxygenase activity.

1. Protein-Protein Interaction Studies Using Pull-Down Assays

The dual tagging system enables technical feasibility for interaction studies. The homologous expression system favors proper folding, which increases confidence in the physiological relevance of identified interactions. However, the tags may still cause steric hindrance or non-specific binding. This application should include appropriate controls (e.g., tag-only controls) to distinguish specific from artifactual interactions.

2. Antibody Development and Validation

The recombinant AlkB can serve as an effective immunogen for generating antibodies against linear epitopes. The high purity supports immunization protocols. However, antibodies may not recognize conformational epitopes if tags affect protein folding. Validation against native E. coli AlkB is recommended.

3. Biochemical Characterization and Enzyme Kinetics Studies

This application is well-suited but requires activity validation for kinetic studies. Basic biochemical characterization is feasible, but enzyme kinetics parameters (Km, Vmax) should only be determined after confirming dioxygenase activity. The tags may affect catalytic efficiency, so results should be interpreted with appropriate controls.

4. Protein Stability and Folding Studies

This application is highly appropriate. Biophysical techniques (circular dichroism, differential scanning calorimetry) can directly assess the protein's folding state and stability. These studies are valuable for characterizing the recombinant E. coli AlkB protein and can inform about its suitability for other applications.

Final Recommendation & Action Plan

Given the homologous expression system, this AlkB has high potential for proper folding and function. Recommended first steps: 1) Validate dioxygenase activity using standard assays with appropriate substrates (methylated DNA/RNA) and cofactors (α-ketoglutarate, Fe²?, ascorbate); 2) Perform biophysical characterization (size-exclusion chromatography, circular dichroism) to confirm proper folding; 3) If possible, compare with tag-cleaved protein to assess tag effects. Antibody development and stability studies can proceed immediately. For interaction studies, include appropriate controls to validate physiological relevance. For reliable kinetic parameters, use activity-verified protein and include known substrates as positive controls.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Dioxygenase that repairs alkylated DNA and RNA containing 3-methylcytosine or 1-methyladenine by oxidative demethylation. Has highest activity towards 3-methylcytosine. Has lower activity towards alkylated DNA containing ethenoadenine, and no detectable activity towards 1-methylguanine or 3-methylthymine. Accepts double-stranded and single-stranded substrates. Requires molecular oxygen, alpha-ketoglutarate and iron. Provides extensive resistance to alkylating agents such as MMS and DMS (SN2 agents), but not to MMNG and MNU (SN1 agents).
Gene References into Functions
  1. SSB-AlkB interaction promotes faster repair of the methyl DNA adducts. PMID: 29326044
  2. AlkB has a wide variety of substrates, including monoalkyl and exocyclic bridged adducts. (Review) PMID: 26152727
  3. AlkB dioxygenase preferentially repairs protonated substrates: specificity against exocyclic adducts and molecular mechanism of action PMID: 23148216
  4. The AlkB dioxygenase plays a major role in decreasing the level of AT-->TA mutations, thus in the repair of Etheno-DNA adducts in E.coli cells. PMID: 21193516
  5. work provides direct evidence that AlkB suppresses both genotoxicity and mutagenesis by physiologically realistic low doses of 1-alkylpurine and 3-alkylpyrimidine DNA damage in vivo PMID: 15381779
  6. AlkB repairs epsilonA and epsilonC genomic lesions. PMID: 16200073
  7. crystal structures of substrate and product complexes of E. coli AlkB at resolutions from 1.8 to 2.3 A PMID: 16482161
  8. AlkB is shown here to be a geno-protective agent that reduces the toxicity of DNA damage by converting the primary adduct to a less toxic secondary product PMID: 17213319
  9. Cocrystal structures provide insight into the structural basis of this "k(cat)/K(m) compensation," which makes a significant contribution to promiscuous substrate recognition by AlkB. PMID: 19706517

Show More

Hide All

Protein Families
AlkB family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*