Recombinant Escherichia coli dITP/XTP pyrophosphatase (rdgB)

In Stock
Code CSB-EP345967ENV
Abbreviation Recombinant E.coli rdgB protein
MSDS
Size US$388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 85% as determined by SDS-PAGE.
Target Names
rdgB
Uniprot No.
Research Area
Others
Alternative Names
rdgB; yggV; b2954; JW2921; dITP/XTP pyrophosphatase; EC 3.6.1.66; Deoxyribonucleoside triphosphate pyrophosphohydrolase; Inosine triphosphate pyrophosphatase; ITPase; Non-canonical purine NTP pyrophosphatase; Non-standard purine NTP pyrophosphatase; Nucleoside-triphosphate diphosphatase; Nucleoside-triphosphate pyrophosphatase; NTPase
Species
Escherichia coli (strain K12)
Source
E.coli
Expression Region
1-197aa
Target Protein Sequence
MQKVVLATGNVGKVRELASLLSDFGLDIVAQTDLGVDSAEETGLTFIENAILKARHAAKVTALPAIADDSGLAVDVLGGAPGIYSARYSGEDATDQKNLQKLLETMKDVPDDQRQARFHCVLVYLRHAEDPTPLVCHGSWPGVITREPAGTGGFGYDPIFFVPSEGKTAAELTREEKSAISHRGQALKLLLDALRNG
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
41.0 kDa
Protein Length
Full Length
Tag Info
N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Escherichia coli dITP/XTP pyrophosphatase (rdgB) is expressed in E. coli and covers the full length of the protein (1-197 amino acids). This product includes an N-terminal 10xHis-SUMO tag and a C-terminal Myc tag, which help with purification and detection. The protein appears to be purified to over 85% purity, as determined by SDS-PAGE, suggesting it should work well for research applications.

dITP/XTP pyrophosphatase is an essential enzyme in Escherichia coli that's involved in nucleotide metabolism. It breaks down non-canonical nucleotides like dITP and XTP to prevent their incorporation into DNA, which helps maintain genomic stability. This function makes it an important subject for studying DNA replication fidelity and how cells respond to nucleotide pool imbalances.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

E. coli rdgB is a bacterial enzyme that hydrolyzes non-canonical nucleotides (dITP/XTP) to prevent their incorporation into DNA. The E. coli expression system is compatible with this bacterial protein, increasing the likelihood of correct folding. However, the dual N-terminal His-SUMO tag (∼20 kDa) and C-terminal Myc tag may sterically interfere with the enzyme's active site or oligomerization. While the full-length protein (1-197aa) contains all functional domains, the large tags may compromise enzymatic activity. The probability of correct folding is moderate, but functional activity requires experimental validation due to potential tag interference.

1. Protein-Protein Interaction Studies Using Tag-Assisted Pull-Down Assays

Protein-protein interactions require a precise tertiary structure that may be compromised by the large dual tags. The large N-terminal SUMO tag and C-terminal Myc tag may sterically block interaction interfaces or cause misfolding, leading to non-specific binding or failure to identify genuine partners (e.g., DNA repair enzymes). If correctly folded, it could reveal physiological interactions, but results require validation with tag-free protein.

2. Antibody Development and Validation Platform

This recombinant rdgB serves as an excellent immunogen for generating antibodies against E. coli rdgB. The full-length sequence ensures comprehensive coverage of the epitope. The dual tags provide additional epitopes for screening and controls for specificity testing. These antibodies will be valuable for detecting rdgB in bacterial samples.

3. Biochemical Characterization and Substrate Specificity Analysis

This is the critical first step to assess protein quality and activity. Techniques like size-exclusion chromatography can determine oligomeric state, while enzymatic assays with dITP/XTP substrates can validate pyrophosphatase activity. However, the tags may sterically hinder substrate access to the active site, potentially yielding false-negative results in activity assays. These analyses are essential but must include activity validation to confirm functional integrity despite the tags.

4. Structural and Biophysical Studies

This application is suitable for basic biophysical characterization but is limited to structural studies. Techniques like circular dichroism can analyze secondary structure, but the large tags will dominate spectroscopic signals and prevent accurate analysis of the native rdgB structure. SEC-MALS can assess oligomeric state but may be affected by tag interference.

Final Recommendation & Action Plan

This dual-tagged recombinant rdgB is reliable for antibody development but requires rigorous activity validation before functional studies due to potential tag interference. The immediate priority is Application 3 (Biochemical Characterization) to test enzymatic activity with dITP/XTP substrates and assess oligomeric state via SEC-MALS. If activity is confirmed despite the tags, proceed cautiously with Application 1 (Interaction Studies). Application 2 (Antibody Development) can proceed immediately. Application 4 should be limited to basic biophysical properties. For reliable structural or detailed functional studies, tag removal or use of tag-free rdgB is recommended. This systematic approach ensures appropriate use based on functional validation.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Pyrophosphatase that catalyzes the hydrolysis of nucleoside triphosphates to their monophosphate derivatives, with a high preference for the non-canonical purine nucleotides XTP (xanthosine triphosphate), dITP (deoxyinosine triphosphate) and ITP. Can also efficiently hydrolyze 2'-deoxy-N-6-hydroxylaminopurine triphosphate (dHAPTP). Seems to function as a house-cleaning enzyme that removes non-canonical purine nucleotides from the nucleotide pool, thus preventing their incorporation into DNA/RNA and avoiding chromosomal lesions. To a much lesser extent, is also able to hydrolyze GTP, dGTP and dUTP, but shows very low activity toward the canonical nucleotides dATP, dCTP and dTTP and toward 8-oxo-dGTP, purine deoxyribose triphosphate, 2-aminopurine deoxyribose triphosphate and 2,6-diaminopurine deoxyribose triphosphate.
Gene References into Functions
  1. RdgB homologs play a preemptive role in excluding endogenous and exogenous modified purine deoxyribonucleoside triphosphate (dTNPs) from incorporation into DNA. PMID: 17090528
  2. These data provide insight into the molecular mechanisms of the substrate selectivity and catalysis of RdgB and other ITPases. PMID: 17976651
Protein Families
HAM1 NTPase family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*