Recombinant Escherichia coli 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase (gpmA)

In Stock
Code CSB-EP351195ENV
Abbreviation Recombinant E.coli gpmA protein
MSDS
Size $388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 95% as determined by SDS-PAGE.
Activity
Not Test
Target Names
gpmA
Uniprot No.
Research Area
Others
Alternative Names
BPG-dependent PGAM;PGAM;Phosphoglyceromutase;dPGM;EC 5.4.2.11
Species
Escherichia coli (strain K12)
Source
E.coli
Expression Region
2-250aa
Target Protein Sequence
AVTKLVLVRHGESQWNKENRFTGWYDVDLSEKGVSEAKAAGKLLKEEGYSFDFAYTSVLKRAIHTLWNVLDELDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFAVTPPELTKDDERYPGHDPRYAKLSEKELPLTESLALTIDRVIPYWNETILPRMKSGERVIIAAHGNSLRALVKYLDNMSEEEILELNIPTGVPLVYEFDENFKPLKRYYLGNADEIAAKAAAVANQGKAK
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
33.5 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Escherichia coli 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase (gpmA) is produced in an E. coli expression system, containing the full length of the mature protein (2-250aa). The protein carries an N-terminal 10xHis tag and a C-terminal Myc tag, which makes purification and detection more straightforward. SDS-PAGE analysis shows purity greater than 95%, suggesting it should deliver reliable results for research applications.

2,3-bisphosphoglycerate-dependent phosphoglycerate mutase appears to play a central role in both glycolytic and gluconeogenesis pathways. It catalyzes the interconversion of 3-phosphoglycerate and 2-phosphoglycerate. The enzyme's activity seems essential for efficient energy production and consumption within cells. Studying this protein may be important for understanding bacterial metabolism, and the findings could potentially inform broader research on metabolic processes.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Based on the provided information, the recombinant E. coli gpmA is expressed in its native E. coli system, which significantly increases the probability of proper folding and functionality. As a bacterial enzyme expressed in its homologous prokaryotic system, gpmA has a high likelihood of correct folding since E. coli contains the necessary chaperones and cellular environment for its own proteins. The protein is full-length mature (2-250aa) with dual tags (N-terminal 10xHis and C-terminal Myc) and exhibits high purity (>95%). However, since activity is unverified and the presence of dual tags may potentially interfere with the active site or oligomerization state, the protein cannot be assumed to be fully functional without experimental validation of its phosphoglycerate mutase activity.

1. Protein-Protein Interaction Studies Using Dual-Tag Pull-Down Assays

The dual tagging system enables technical feasibility for interaction studies, but caution is warranted. While E. coli expression favors proper folding, the tags may still affect protein conformation or oligomerization. If gpmA is properly folded, pull-down assays could identify genuine metabolic interactors. However, the tags might cause steric hindrance or non-specific interactions. This application should include controls to distinguish specific from tag-mediated interactions.

2. Antibody Development and Validation Platform

This application is appropriate and relatively low-risk. The recombinant gpmA can serve as an effective immunogen for generating antibodies against linear epitopes. The high purity supports immunization protocols. However, antibodies may not recognize conformational epitopes if tags affect protein folding. Validation against native E. coli gpmA is recommended to ensure recognition of the endogenous enzyme.

3. Comparative Biochemical Analysis and Enzyme Characterization

This application is well-suited but requires activity validation for functional studies. Basic biophysical characterization (thermal stability, oligomeric state) is feasible and valuable. However, enzymatic assays (kinetic parameters, cofactor studies) should only be performed after confirming mutase activity. The tags may affect catalytic efficiency or substrate binding, so results should be interpreted cautiously.

4. Tag-Assisted Protein Complex Assembly Studies

This application carries a significant risk. While the tags enable technical approaches for complex assembly, they may drive non-physiological oligomerization or interactions. gpmA functions in metabolic complexes, but tag-mediated assembly may not reflect native metabolon formation. This application should only be pursued after confirming that tags don't interfere with native structure and function.

Final Recommendation & Action Plan

Given the homologous expression system, this gpmA has high potential for proper folding and function. Recommended first steps: 1) Validate phosphoglycerate mutase activity using standard enzymatic assays with 2,3-bisphosphoglycerate and 3-phosphoglycerate substrates; 2) Perform biophysical characterization (size-exclusion chromatography, circular dichroism) to confirm proper folding and oligomeric state; 3) If possible, compare with tag-cleaved protein to assess tag effects. Antibody development can proceed immediately. For interaction and complex studies, include appropriate controls (e.g., tag-only controls, competition experiments) and validate findings with native E. coli extracts. For precise functional studies, consider using a tag-cleaved protein or verifying that tags don't affect enzymatic activity.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Catalyzes the interconversion of 2-phosphoglycerate and 3-phosphoglycerate.
Protein Families
Phosphoglycerate mutase family, BPG-dependent PGAM subfamily
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*