Recombinant Escherichia coli 3-demethoxyubiquinol 3-hydroxylase (ubiF)

In Stock
Code CSB-EP301152ENV
Abbreviation Recombinant E.coli ubiF protein
MSDS
Size $388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
ubiF
Uniprot No.
Research Area
others
Alternative Names
2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase
Species
Escherichia coli (strain K12)
Source
E.coli
Expression Region
1-391aa
Target Protein Sequence
MTNQPTEIAIVGGGMVGGALALGLAQHGFAVTVIEHAEPAPFVADSQPDVRISAISAASVSLLKGLGVWDAVQAMRCHPYRRLETWEWETAHVVFDAAELKLPLLGYMVENTVLQQALWQALEAHPKVTLRVPGSLIALHRHDDLQELELKGGEVIRAKLVIGADGANSQVRQMAGIGVHAWQYAQSCMLISVQCENDPGDSTWQQFTPDGPRAFLPLFDNWASLVWYDSPARIRQLQNMNMAQLQAEIAKHFPSRLGYVTPLAAGAFPLTRRHALQYVQPGLALVGDAAHTIHPLAGQGVNLGYRDVDALIDVLVNARSYGEAWASYPVLKRYQMRRMADNFIMQSGMDLFYAGFSNNLPPLRFMRNLGLMAAERAGVLKRQALKYALGL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
46.5 kDa
Protein Length
Full Length
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Escherichia coli 3-demethoxyubiquinol 3-hydroxylase (ubiF) is expressed in E.coli and includes an N-terminal 6xHis-tag that makes purification more straightforward. The product contains the full-length protein from amino acids 1 to 391, reaching a purity greater than 85% as verified by SDS-PAGE. This protein is designed solely for research purposes and appears to be a reliable tool for scientific investigation.

3-demethoxyubiquinol 3-hydroxylase is an enzyme that participates in the biosynthesis of ubiquinone, also known as coenzyme Q. This protein plays what seems to be a crucial role in the electron transport chain, helping to drive cellular energy production. Its activity is likely essential for maintaining cellular respiration and metabolic efficiency, which makes it an important subject of study in microbial and biochemical research.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Based on the provided information, the recombinant E. coli ubiF protein has a high probability of being correctly folded and bioactive. This is supported by several factors: 1) The protein is expressed in its native E. coli system, which provides the appropriate cellular environment for correct folding and any necessary cofactor incorporation; 2) It is full-length (1-391aa), containing all functional domains; 3) The N-terminal 6xHis tag is relatively small and unlikely to significantly interfere with folding or function; 4) The purity >85% indicates minimal contaminants. However, without explicit experimental validation of enzymatic activity, we cannot definitively guarantee bioactivity. The protein should be functionally competent but requires standard verification.

1. Ubiquinone Biosynthesis Pathway Studies

This recombinant ubiF protein is appropriate for studying the ubiquinone biosynthesis pathway. As it's expressed in its native E. coli system and contains the full functional domain, it is highly like maintain proper folding and enzymatic activity. Researchers can confidently use it for in vitro assays investigating the conversion of 3-demethoxyubiquinol to ubiquinol-8. The 6xHis tag facilitates purification without significant functional compromise.

2. Protein-Protein Interaction Studies

The His-tagged ubiF is suitable for pull-down assays to identify interaction partners within the ubiquinone biosynthesis machinery. The native expression system increases confidence that the protein will present authentic interaction surfaces. The high purity (>85%) supports reliable results, though standard controls should be included to rule out tag-mediated artifacts.

3. Antibody Development and Validation

This full-length recombinant protein is well-suited for generating specific antibodies against E. coli ubiF. The native folding ensures that antibodies will recognize conformational epitopes relevant to the physiological protein. The His-tag also provides a purification handle for immunization protocols.

4. Comparative Enzymology and Evolution Studies

The recombinant ubiF is excellent for comparative studies with homologs from other bacteria. The standardized expression in the native host ensures proper folding, enabling meaningful functional comparisons across species. The conservation of this essential metabolic pathway makes such comparative analyses particularly valuable.

Final Recommendation & Action Plan

This recombinant ubiF protein appears highly suitable for the proposed applications. To ensure optimal results: 1) Confirm enzymatic activity using established ubiquinone conversion assays before quantitative studies; 2) For interaction studies, include appropriate controls (e.g., bead-only and tag-only) to validate specificity; 3) For antibody production, characterize serum specificity using ubiF-deficient E. coli strains; 4) In comparative studies, standardize assay conditions across homologs. The native expression system provides significant advantages for functional studies of this E. coli enzyme.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Catalyzes the hydroxylation of 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol during ubiquinone biosynthesis.
Gene References into Functions
  1. sucB and ubiF mutants deficient in energy production were identified from the mutant screens to have defective persister survival as demonstrated by higher susceptibility to various antibiotics and different stresses. PMID: 20041955
  2. 2-octoprenyl-3-methyl-6-methoxy-1,4-benzoquinol oxygenase PMID: 10802164
Subcellular Location
Cytoplasm.
Protein Families
UbiH/COQ6 family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*