Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

eltB

Uniprot No.

P0CK94

Research Area

Others

Alternative Names

eltB; ltpBHeat-labile enterotoxin B chain; LT-B; human; LTH-B

Species

Escherichia coli

Source

E.coli

Expression Region

22-124aa

Target Protein Sequence

APQSITELCSEYHNTQIYTINDKILSYTESMAGKREMVIITFKSGATFQVEVPGSQHIDSQKKAIERMKDTLRITYLTETKIDKLCVWNNKTPNSIAAISMEN
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

17 kDa

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 6xHis-tagged and C-terminal 6xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

The expression region of this recombinant Escherichia coli eltB covers amino acids 22-124. This eltB protein is expected to have a theoretical molecular weight of 17 kDa. This eltB protein is produced using e.coli expression system. The N-terminal 6xHis tag and C-terminal 6xHis tag was smoothly integrated into the coding gene of eltB, which enables a simple process of detecting and purifying the eltB recombinant protein in the following steps.

The Escherichia coli heat-labile enterotoxin B chain (EltB) is a component of the heat-labile enterotoxin (LT) produced by certain strains of E. coli. LT is a major virulence factor associated with enterotoxigenic E. coli (ETEC), a pathotype known for causing traveler's diarrhea and infantile diarrhea in developing countries. EltB forms a heterohexameric complex with the A subunit (EltA), and together, they constitute the biologically active toxin. EltB is responsible for binding to host cell surface receptors, facilitating the internalization of the toxin into the intestinal epithelial cells. Once inside the cells, the A subunit exerts its toxic effects, leading to an increase in intracellular cyclic AMP (cAMP) levels, which disrupts ion transport and water balance, resulting in diarrhea. Understanding the structure and function of EltB is crucial for developing strategies to prevent ETEC infections.

Code	CSB-EP315643ENL
Abbreviation	Recombinant E.coli eltB protein
MSDS	MSDS Datasheet
Size	US$388
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Escherichia coli Heat-labile enterotoxin B chain (eltB)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage